![Western Blot: MOB4A/MOBKL1B Antibody - Azide and BSA Free [MOB4A/MOBKL1B] - Western blot analysis of various lysates, using MOB1A/MOB2B Rabbit pAb at 1:1500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.](http://images.novusbio.com/fullsize/nbp2-95097_rabbit-polyclonal-mob4a-mobkl1b-antibody-5220251638099.jpg "Western Blot: MOB4A/MOBKL1B Antibody - Azide and BSA Free [MOB4A/MOBKL1B] - Western blot analysis of various lysates, using MOB1A/MOB2B Rabbit pAb at 1:1500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Rabbit MOB4A/MOBKL1B Antibody - Azide and BSA Free (NBP2-95097) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human MOB4A/MOBKL1B (NP_060691.2/NP_775739.1). TILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR/MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MOB1B |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MOB1B |
![Western Blot: MOB4A/MOBKL1B Antibody - Azide and BSA Free [MOB4A/MOBKL1B] - Western blot analysis of various lysates, using MOB4A/MOBKL1B Rabbit pAb at 1:1500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.](http://images.novusbio.com/fullsize/nbp2-95097_rabbit-polyclonal-mob4a-mobkl1b-antibody-5220251639620.jpg "Western Blot: MOB4A/MOBKL1B Antibody - Azide and BSA Free [MOB4A/MOBKL1B] - Western blot analysis of various lysates, using MOB4A/MOBKL1B Rabbit pAb at 1:1500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.")
![Immunocytochemistry/Immunofluorescence: MOB4A/MOBKL1B Antibody [NBP2-95097] - Analysis of L929 cells using MOB4A/MOBKL1B at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/MOB4A-MOBKL1B-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-95097-img0001.jpg "Immunocytochemistry/Immunofluorescence: MOB4A/MOBKL1B Antibody [NBP2-95097] - Analysis of L929 cells using MOB4A/MOBKL1B at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Bioactivity MSP/MST1 [Unconjugated]](https://images.novusbio.com/images/352-ms_recombinant-human-msp-mst1-protein-bioactivity-112202583129..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")