MNK1 Antibody [DyLight 650]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: DyLight 650

MNK1 Antibody [DyLight 650] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 374-465 of human MNK1 (NP_003675.2).
  
  Sequence:
  VQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENELAEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MKNK1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for MNK1 Antibody [DyLight 650]

• EC 2.7.11
• EC 2.7.11.1
• MAP kinase interacting kinase 1
• MAP kinase interacting serine/threonine kinase 1
• MAP kinase signal-integrating kinase 1
• MAP kinase-interacting serine/threonine-protein kinase 1
• MKNK1
• MNK1
• MNK1MAP kinase-interacting serine/threonine kinase 1

Background

MNK1 may play a role in the response to environmental stress and cytokines. It appears to regulate transcription by phosphorylating EIF4E, thus increasing the affinity of this protein for the 7-methylguanosine-containing mRNA cap.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MKNK1