MNK1 Antibody - BSA Free

Immunohistochemistry: MNK1 Antibody [NBP3-35840] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using MNK1 Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: MNK1 Antibody [NBP3-35840] - Immunofluorescence analysis of NIH-3T3 cells using MNK1 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: MNK1 Antibody [NBP3-35840] - Immunohistochemistry analysis of paraffin-embedded Rat fallopian tube using MNK1 Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Western Blot: MNK1 Antibody [NBP3-35840] - Western blot analysis of various lysates, using MNK1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 180s.

Immunohistochemistry: MNK1 Antibody [NBP3-35840] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer using MNK1 Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MNK1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MNK1 Antibody - BSA Free (NBP3-35840) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 374-465 of human MNK1 (NP_003675.2).
  
  Sequence:
  VQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENELAEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MKNK1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 51 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MNK1 Antibody - BSA Free

• EC 2.7.11
• EC 2.7.11.1
• MAP kinase interacting kinase 1
• MAP kinase interacting serine/threonine kinase 1
• MAP kinase signal-integrating kinase 1
• MAP kinase-interacting serine/threonine-protein kinase 1
• MKNK1
• MNK1
• MNK1MAP kinase-interacting serine/threonine kinase 1

Background

MNK1 may play a role in the response to environmental stress and cytokines. It appears to regulate transcription by phosphorylating EIF4E, thus increasing the affinity of this protein for the 7-methylguanosine-containing mRNA cap.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MKNK1