MNAT1 Antibody

Images

 
Western Blot: MNAT1 Antibody [NBP2-85300] - WB Suggested Anti-MNAT1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: 721_B cell lysateMNAT1 is supported by BioGPS gene expression data to be ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MNAT1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human MNAT1. Peptide sequence: DDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGT The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Porcine (100%), Bovine (100%), Zebrafish (100%), Canine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
MNAT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MNAT1 Antibody

  • CAP35
  • CDK7/cyclin-H assembly factor
  • cyclin G1 interacting protein
  • Cyclin-G1-interacting protein
  • MAT1TFB3
  • menage a trois 1 (CAK assembly factor)
  • menage a trois homolog 1, cyclin H assembly factor (Xenopus laevis)
  • Menage a trois
  • p35
  • p36
  • RING finger protein 66
  • RING finger protein MAT1
  • RNF66CDK-activating kinase assembly factor MAT1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67719
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-581
Species: Hu, Mu, Rt
Applications: WB, IHC, IP, ICC
AF2396
Species: Hu
Applications: WB, Simple Western, IHC
NB100-61060
Species: Hu, Mu, V-Vi
Applications: WB, ChIP, IP
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
NBP3-07348
Species: Hu
Applications: Flow, ICC/IF, PA
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP3-04662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBL1-11392
Species: Hu
NBP2-00776
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF3296
Species: Hu, Mu, Rt
Applications: WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-322
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-82774
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Mar, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-29463
Species: Hu, Mu, Rt, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20415
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-85300
Species: Hu, Mu, Rt, Po, Bv, Ca, Ze
Applications: WB

Publications for MNAT1 Antibody (NBP2-85300) (0)

There are no publications for MNAT1 Antibody (NBP2-85300).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MNAT1 Antibody (NBP2-85300) (0)

There are no reviews for MNAT1 Antibody (NBP2-85300). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MNAT1 Antibody (NBP2-85300) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MNAT1 Products

Bioinformatics Tool for MNAT1 Antibody (NBP2-85300)

Discover related pathways, diseases and genes to MNAT1 Antibody (NBP2-85300). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MNAT1 Antibody (NBP2-85300)

Discover more about diseases related to MNAT1 Antibody (NBP2-85300).
 

Pathways for MNAT1 Antibody (NBP2-85300)

View related products by pathway.

PTMs for MNAT1 Antibody (NBP2-85300)

Learn more about PTMs related to MNAT1 Antibody (NBP2-85300).
 

Research Areas for MNAT1 Antibody (NBP2-85300)

Find related products by research area.

Blogs on MNAT1

There are no specific blogs for MNAT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MNAT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MNAT1