MMR/CD206/Mannose Receptor Antibody (CL0387)

Images

 
Western Blot: MMR/CD206/Mannose Receptor Antibody (CL0387) [NBP2-52927] - Lane 1: Marker [kDa], Lane 2: Human liver tissue lysate
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody (CL0387) [NBP2-52927] - Human stomach cancer FFPE block stained with CD206 antibody at 1:2000 overnight. IHC-P image submitted by a verified customer ...read more
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody (CL0387) [NBP2-52927] - Staining of human cerebellum shows absence of immunoreactivity.
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody (CL0387) [NBP2-52927] - Staining of human liver shows strong positivity in Kupffer cells.
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody (CL0387) [NBP2-52927] - Staining of human lung shows strong immunoreactivity in macrophages.
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody (CL0387) [NBP2-52927] - Staining of human rectum shows moderate positivity in a subset of lymphoid cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clone
CL0387
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MMR/CD206/Mannose Receptor Antibody (CL0387) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG
Epitope
VSPSAVQTAACNQDA
Isotype
IgG2b
Clonality
Monoclonal
Host
Mouse
Gene
MRC1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 1 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. MMR/CD206/Mannose Receptor antibody validated for IHC-P from a verified customer review.
Control Peptide
MMR/CD206/Mannose Receptor Recombinant Protein Antigen (NBP2-52927PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-52927 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (86%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for MMR/CD206/Mannose Receptor Antibody (CL0387)

  • CD206
  • CLEC13D
  • CLEC13Dmacrophage mannose receptor 1
  • C-type lectin domain family 13 member D
  • mannose receptor, C type 1
  • MMR
  • MMRCD206 antigen
  • MRC1

Background

The Mannose Receptor (MR), a member of the vertebrate C-type lectin family, is a pattern recognition receptor that is involved in both innate and adaptive immunity. The 180 kDa transmembrane protein consists of 5 domains: an amino-terminal cysteine-rich region, a fibronectin type II repeat, a series of eight tandem lectin-like carbohydrate recognition domains (responsible for the recognition of mannose and fucose), a transmembrane domain, and an intracellular carboxy-terminal tail.The structure is shared by the family of multi lectin mannose receptors: the phospholipase A2-receptor, DEC 205 and the novel C-type lectin receptor (mannose receptor X). The MR recognises a wide range of gram positive and gram negative bacteria, yeasts, parasites and mycobacteria. The MR has also been shown to bind and internalize tissue-type plasminogen activator. MR's are present on monocytes and dendritic cells (DC) and are presumed to play a role in innate and adaptive immunity, the latter via processing by DC. The expression of MR as observed in immunohistology is present on tissue macrophages, dendritic cells, a subpopulation of endothelial cells, Kupffer cells and sperm cells. The expression of MR on monocytes increases during culture and can be enhanced by cytokines such as IFN-gamma. Labeling of MR expressing monocytes/macrophages increases with prolonged incubation time probably due to internalization of the MR-antibody-complex. The antibody 15-2 prevents binding of glycoproteins including t-PA to MR. Detection of the MR with anti-MR monoclonal antibody 15-2 can substitute staining for mannose containing probes as labeled mannosylated BSA, a technique which is more cumbersome and less specific.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP3-07211
Species: Ca, Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-83319
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46459
Species: Hu
Applications: ICC/IF, IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-19417
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-13739
Species: Hu
Applications: ELISA, Flow, ICC/IF, IP, PA
AF1626
Species: Hu
Applications: ICC, WB
DY417
Species: Mu
Applications: ELISA
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
210-TA
Species: Hu
Applications: BA
6507-IL/CF
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-86509
Species: Hu
Applications: IHC, IHC-P
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
NB100-168
Species: Hu, Mu(-)
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-93743
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-52927
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MMR/CD206/Mannose Receptor Antibody (NBP2-52927) (0)

There are no publications for MMR/CD206/Mannose Receptor Antibody (NBP2-52927).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for MMR/CD206/Mannose Receptor Antibody (NBP2-52927) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-52927:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin MMR/CD206/Mannose Receptor NBP2-52927
Enlarge
5
reviewed by:
Lucia Montorsi
IHC-P Human 03/30/2021
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample Testedstomach cancer FFPE block
SpeciesHuman
LotMAB-03457

Comments

CommentsAntigen retrieval: Basic Buffer (ph9), Incubation overnight 1:2000

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MMR/CD206/Mannose Receptor Antibody (NBP2-52927) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MMR/CD206/Mannose Receptor Products

Bioinformatics Tool for MMR/CD206/Mannose Receptor Antibody (NBP2-52927)

Discover related pathways, diseases and genes to MMR/CD206/Mannose Receptor Antibody (NBP2-52927). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMR/CD206/Mannose Receptor Antibody (NBP2-52927)

Discover more about diseases related to MMR/CD206/Mannose Receptor Antibody (NBP2-52927).
 

Pathways for MMR/CD206/Mannose Receptor Antibody (NBP2-52927)

View related products by pathway.

PTMs for MMR/CD206/Mannose Receptor Antibody (NBP2-52927)

Learn more about PTMs related to MMR/CD206/Mannose Receptor Antibody (NBP2-52927).
 

Research Areas for MMR/CD206/Mannose Receptor Antibody (NBP2-52927)

Find related products by research area.

Blogs on MMR/CD206/Mannose Receptor.

Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Lucia Montorsi
03/30/2021
Application: IHC-P
Species: Human

Bioinformatics

Gene Symbol MRC1