Home » MMR/CD206/Mannose Receptor » MMR/CD206/Mannose Receptor Antibodies » MMR/CD206/Mannose Receptor Antibody (CL0387)

MMR/CD206/Mannose Receptor Antibody (CL0387)

 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: MMR/CD206/Mannose Receptor Antibody (CL0387) [NBP2-52927] - Lane 1: Marker [kDa], Lane 2: Human liver tissue lysate
Western Blot: MMR/CD206/Mannose Receptor Antibody (CL0387) [NBP2-52927] - Lane 1: Marker [kDa], Lane 2: Human liver tissue lysate
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody (CL0387) [NBP2-52927] - Human stomach cancer FFPE block stained with CD206 antibody at 1:2000 overnight. IHC-P image submitted by a verified customer ...read more
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody (CL0387) [NBP2-52927] - Staining of human cerebellum shows absence of immunoreactivity.
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody (CL0387) [NBP2-52927] - Staining of human liver shows strong positivity in Kupffer cells.
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody (CL0387) [NBP2-52927] - Staining of human lung shows strong immunoreactivity in macrophages.
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody (CL0387) [NBP2-52927] - Staining of human rectum shows moderate positivity in a subset of lymphoid cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clone
CL0387
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

MMR/CD206/Mannose Receptor Antibody (CL0387) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG
Epitope
VSPSAVQTAACNQDA
Isotype
IgG2b
Clonality
Monoclonal
Host
Mouse
Gene
MRC1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 1 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. MMR/CD206/Mannose Receptor antibody validated for IHC-P from a verified customer review.
Control Peptide
MMR/CD206/Mannose Receptor Recombinant Protein Antigen (NBP2-52927PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-52927 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (86%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for MMR/CD206/Mannose Receptor Antibody (CL0387)

  • CD206
  • CLEC13D
  • CLEC13Dmacrophage mannose receptor 1
  • C-type lectin domain family 13 member D
  • mannose receptor, C type 1
  • MMR
  • MMRCD206 antigen
  • MRC1

Background

The Mannose Receptor (MR), a member of the vertebrate C-type lectin family, is a pattern recognition receptor that is involved in both innate and adaptive immunity. The 180 kDa transmembrane protein consists of 5 domains: an amino-terminal cysteine-rich region, a fibronectin type II repeat, a series of eight tandem lectin-like carbohydrate recognition domains (responsible for the recognition of mannose and fucose), a transmembrane domain, and an intracellular carboxy-terminal tail.The structure is shared by the family of multi lectin mannose receptors: the phospholipase A2-receptor, DEC 205 and the novel C-type lectin receptor (mannose receptor X). The MR recognises a wide range of gram positive and gram negative bacteria, yeasts, parasites and mycobacteria. The MR has also been shown to bind and internalize tissue-type plasminogen activator. MR's are present on monocytes and dendritic cells (DC) and are presumed to play a role in innate and adaptive immunity, the latter via processing by DC. The expression of MR as observed in immunohistology is present on tissue macrophages, dendritic cells, a subpopulation of endothelial cells, Kupffer cells and sperm cells. The expression of MR on monocytes increases during culture and can be enhanced by cytokines such as IFN-gamma. Labeling of MR expressing monocytes/macrophages increases with prolonged incubation time probably due to internalization of the MR-antibody-complex. The antibody 15-2 prevents binding of glycoproteins including t-PA to MR. Detection of the MR with anti-MR monoclonal antibody 15-2 can substitute staining for mannose containing probes as labeled mannosylated BSA, a technique which is more cumbersome and less specific.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MLH1 Antibody
(SP08-04)
NBP2-67381
Flow Cytometry: MLH1 Antibody (SP08-04) [NBP2-67381] - Analysis of Hela cells with MLH1 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody
Immunocytochemistry/Immunofluorescence: MLH1 Antibody (SP08-04) [NBP2-67381] - Staining MLH1 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: MLH1 Antibody (SP08-04) [NBP2-67381] - Immunohistochemical analysis of paraffin-embedded human tonsil tissue using anti-MLH1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes. The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (ET1604-41, 1/200) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
MSH2 Antibody
(MSH2/2622)
NBP3-07211
Flow Cytometry: MSH2 Antibody (MSH2/2622) [NBP3-07211] - Flow Cytometric Analysis of A549 cells using MSH2 Mouse Monoclonal Antibody (MSH2/2622) followed by goat anti- Mouse IgG-CF488 (Blue); Isotype Control (Red).
Immunocytochemistry/Immunofluorescence: MSH2 Antibody (MSH2/2622) [NBP3-07211] - Immunofluorescence staining of MOLT-4 cells using MSH2 Mouse Monoclonal Antibody (MSH2/2622) followed by goat anti- Mouse IgG-CF488 (green). Membrane are stained with Phalloidin (Red).
Immunohistochemistry-Paraffin: MSH2 Antibody (MSH2/2622) [NBP3-07211] - Formalin-fixed, paraffin-embedded human Colon from Lynch disease stained with MSH2 Mouse Monoclonal Antibody (MSH2/2622).
Species: Ca, Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MSH6 Antibody
NBP1-83319
Immunocytochemistry/Immunofluorescence: MSH6 Antibody [NBP1-83319] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319] - Staining of human fallopian tube, liver, lymph node and testis using Anti-MSH6 antibody NBP1-83319 (A) shows similar protein distribution across tissues to independent antibody NBP1-83318 (B).
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PMS2 Antibody
(OTI2G5)
NBP2-46459
Immunofluorescence: PMS2 Antibody (OTI2G5) [NBP2-46459] - Analysis of HeLa cells.
Immunohistochemistry: PMS2 Antibody (OTI2G5) [NBP2-46459] - Analysis of Adenocarcinoma of Human breast tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: PMS2 Antibody (OTI2G5) [NBP2-46459] - Analysis of Adenocarcinoma of Human colon tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
(1 Publication)
Species: Hu
Applications: ICC/IF, IF, IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on A549 cells with p53 (PAb240) NB200-103AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by APC-conjugated anti-mouse IgG secondary antibody F0101B.
(3 Reviews)
(34 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MSH3 Antibody
NBP2-19417
Immunohistochemistry-Paraffin: MSH3 Antibody [NBP2-19417] - Human lung cancer. MSH3 stained by MSH3 antibody [C2C3], C-term diluted at 1:600. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Immunohistochemistry-Paraffin: MSH3 Antibody [NBP2-19417] - Human colon carcinoma, using MSH3 antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: MSH3 Antibody [NBP2-19417] - HeLa whole cell and nuclear extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with MSH3 antibody [C2C3], C-term diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PMS1 Antibody
(PCRP-PMS1-2E11)
NBP3-13739
Flow Cytometry: PMS1 Antibody (PCRP-PMS1-2E11) [NBP3-13739] - Flow cytometric analysis of PFA-fixed HeLa cells. PMS1 antibody (PCRP-PMS1-2E11) followed by goat anti-mouse IgG-CF488 (blue); isotype control (red).
Immunocytochemistry/Immunofluorescence: PMS1 Antibody (PCRP-PMS1-2E11) [NBP3-13739] - Immunofluorescence Analysis of PFA-fixed HeLa cells stained using PMS1 Antibody (PCRP-PMS1-2E11) [CF488]. PMS1 localized to nucleoplasm and nuclear bodies. Microtubules stained with CF640R.
Protein Array: PMS1 Antibody (PCRP-PMS1-2E11) [NBP3-13739] - Analysis of Protein Array containing more than 19,000 full-length human proteins using PMS1 Antibody (PCRP-PMS1-2E11).
Species: Hu
Applications: ELISA, Flow, ICC/IF, IP, PA
Chk2 [p Thr68]
Antibody [Unconjugate
AF1626
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line untreated (-) or treated (+) with 1 µM camptothecin (CPT) for 1 hour. PVDF membrane was probed with 0.5 µg/mL Rabbit Anti-Human Phospho‑Chk2 (T68) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1626) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band for Phospho-Chk2 (T68) was detected at approximately 64 kDa (as indicated). The phospho-specificity of this antibody was supported by decreased labeling following treatment with 600 U lambda -phosphatase ( lambda -PPase) for  60 minutes. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Phopsho-Chk2 (T68) was detected in immersion fixed HepG2 human hepatocellular carcinoma cell line treated with 1 µM camptothecin using Rabbit Anti-Human Phospho-Chk2 (T68) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1626) at 1 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (red; Catalog # NL004) and counterstained with DAPI (blue). Specific staining was localized to nuclei in treated cells. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(7 Publications)
Species: Hu
Applications: ICC, WB
IL-10 [Biotin]
DY417
(266 Publications)
Species: Mu
Applications: ELISA
APC Antibody - BSA
Free
NB100-91662
Immunocytochemistry/Immunofluorescence: APC Antibody [NB100-91662] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-APC Antibody at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: APC Antibody [NB100-91662] - An intracellular stain was performed on HeLa cells with APC Antibody NB100-91662AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Immunohistochemistry-Paraffin: APC Antibody [NB100-91662] - Paraffin-embedded human colon carcinoma tissue.
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(3 Reviews)
(741 Publications)
Species: Hu
Applications: BA
IL-4 [Unconjugated]
6507-IL/CF
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.05-0.2 ng/mL.
(3 Publications)
Species: Hu
Applications: BA
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.Both antibodies were conjugated to phycoerythrin.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(24 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Coagulation Factor
XIV/Protein C Antibod ...
NBP1-86509
Immunohistochemistry-Paraffin: Coagulation Factor XIV/Protein C Antibody [NBP1-86509] - Staining of human fallopian tube shows positivity in plasma.
Immunohistochemistry-Paraffin: Coagulation Factor XIV/Protein C Antibody [NBP1-86509] - Staining of human liver shows weak cytoplasmic positivity in hepatocytes and strong positivity in plasma.
Immunohistochemistry-Paraffin: Coagulation Factor XIV/Protein C Antibody [NBP1-86509] - Staining of human skin shows no positivity in squamous epithelial cells as expected.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
PCNA Antibody
(PC10)
NB500-106
Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - HeLa cells were fixed and permeabilized for 10 minutes using cold (-20C) MeOH. The cells were incubated with anti-PCNA [PC10] at 5 ug/mL overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: PCNA Antibody (PC10) [NB500-106] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/mL anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Flow Cytometry: PCNA Antibody (PC10) [NB500-106] - An intracellular stain was performed on HepG2 cells with PCNA Antibody (PC10) NB500-106G (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 488.
(5 Reviews)
(40 Publications)
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Analysis of Protein Array containing more than 19,000 full-length human proteins using HLA DQ/DR/DP Antibody (HLA-Pan/2967R). Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProt(TM) array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProt(TM) are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target. A MAb is considered to specific to its intended target, if the MAb has an S-score of at least 2.5.
Immunocytochemistry/Immunofluorescence: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Immunofluorescence staining of Raji cells using HLA DQ/DR/DP Antibody (HLA-Pan/2967R) followed by goat anti-rabbit IgG-CF488 (Green). Nuclei stained with RedDot (Red).
Western Blot: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Western Blot Analysis of Ramos cell lysate using HLA DQ/DR/DP Antibody (HLA-Pan/2967R).
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Publications)
Species: Hu
Applications: BA
MGMT Antibody (MT
23.2) - BSA Free
NB100-168
Flow (Intracellular): MGMT Antibody (MT 23.2) [NB100-168] - An intracellular stain was performed on Jurkat cells with MGMT Antibody (MT 23.2) antibody NB100-168AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: MGMT Antibody (MT 23.2) [NB100-168] - An intracellular stain was performed on HeLa cells with MGMT Antibody (MT 23.2) antibody NB100-168 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) PE-conjugated secondary antibody (F0102B, R&D Systems).
Flow (Intracellular): MGMT Antibody (MT 23.2) [NB100-168] - An intracellular stain was performed on Jurkat cells with MGMT Antibody (MT 23.2) antibody NB100-168 (blue) and a matched isotype control NBP2-27231 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody (F0101B, R&D Systems).
(21 Publications)
Species: Hu, Mu(-)
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NDUFA2 Antibody
NBP2-93743
Immunocytochemistry/Immunofluorescence: NDUFA2 Antibody [NBP2-93743] - Analysis of NIH/3T3 cells using NDUFA2 at dilution of 1:100. Blue: DAPI for nuclear staining.
Western Blot: NDUFA2 Antibody [NBP2-93743] - Analysis of extracts of various cell lines, using NDUFA2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
MMR/CD206/Mannose
Receptor Antibody (CL ...
NBP2-52927
MMR/CD206/Mannose Receptor Antibody (CL0387)
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MMR/CD206/Mannose Receptor Antibody (NBP2-52927) (0)

There are no publications for MMR/CD206/Mannose Receptor Antibody (NBP2-52927).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for MMR/CD206/Mannose Receptor Antibody (NBP2-52927) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-52927:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin MMR/CD206/Mannose Receptor NBP2-52927
Enlarge 		5
reviewed by:
Lucia Montorsi
 IHC-P Human 03/30/2021
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample Testedstomach cancer FFPE block
SpeciesHuman
LotMAB-03457

Comments

CommentsAntigen retrieval: Basic Buffer (ph9), Incubation overnight 1:2000

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MMR/CD206/Mannose Receptor Antibody (NBP2-52927) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MMR/CD206/Mannose Receptor Products

Bioinformatics Tool for MMR/CD206/Mannose Receptor Antibody (NBP2-52927)

Discover related pathways, diseases and genes to MMR/CD206/Mannose Receptor Antibody (NBP2-52927). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMR/CD206/Mannose Receptor Antibody (NBP2-52927)

Discover more about diseases related to MMR/CD206/Mannose Receptor Antibody (NBP2-52927).
 

Pathways for MMR/CD206/Mannose Receptor Antibody (NBP2-52927)

View related products by pathway.

PTMs for MMR/CD206/Mannose Receptor Antibody (NBP2-52927)

Learn more about PTMs related to MMR/CD206/Mannose Receptor Antibody (NBP2-52927).
 

Research Areas for MMR/CD206/Mannose Receptor Antibody (NBP2-52927)

Find related products by research area.

Blogs on MMR/CD206/Mannose Receptor.

Check out the latest blog posts on MMR/CD206/Mannose Receptor.

  Read full blog post.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0
Immunohistochemistry-Paraffin MMR/CD206/Mannose Receptor NBP2-52927
Enlarge
 Lucia Montorsi
03/30/2021
Application: IHC-P
Species: Human
read this review

Bioinformatics

Gene Symbol MRC1