MMP28 Antibody (3C11)


Sandwich ELISA: MMP28 Antibody (3C11) [H00079148-M01] - Detection limit for recombinant GST tagged MMP28 is 0.03 ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA

Order Details

MMP28 Antibody (3C11) Summary

MMP28 (NP_077278, 441 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LARGGLQVEPYYPRSLQDWGGIPEEVSGALPRPDGSIIFFRDDRYWRLDQAKLQATTSGRWATELPWMGCWHANSGSALF
MMP28 (3C11)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:500
  • Sandwich ELISA
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
In 1x PBS, pH 7.4
No Preservative
IgG purified


This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MMP28 Antibody (3C11)

  • EC 3.4.24
  • EC 3.4.24.-
  • Epilysin
  • matrix metallopeptidase 28
  • matrix metalloproteinase 28
  • MM28
  • MMP25
  • MMP28
  • MMP-28
  • MMP-28MMP-25
  • putative MMP28 gene product


Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix for both normal physiological processes, such as embryonic development, reproduction and tissue remodeling, and disease processes, such as asthma and metastasis. This gene encodes a secreted enzyme that degrades casein. Its expression pattern suggests that it plays a role in tissue homeostasis and in wound repair. Transcript variants encoding different isoforms have been described.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ca
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, B/N
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for MMP28 Antibody (H00079148-M01) (0)

There are no publications for MMP28 Antibody (H00079148-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MMP28 Antibody (H00079148-M01) (0)

There are no reviews for MMP28 Antibody (H00079148-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MMP28 Antibody (H00079148-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional MMP28 Products

Bioinformatics Tool for MMP28 Antibody (H00079148-M01)

Discover related pathways, diseases and genes to MMP28 Antibody (H00079148-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMP28 Antibody (H00079148-M01)

Discover more about diseases related to MMP28 Antibody (H00079148-M01).

Pathways for MMP28 Antibody (H00079148-M01)

View related products by pathway.

PTMs for MMP28 Antibody (H00079148-M01)

Learn more about PTMs related to MMP28 Antibody (H00079148-M01).

Blogs on MMP28

There are no specific blogs for MMP28, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MMP28 Antibody (3C11) and receive a gift card or discount.


Gene Symbol MMP28