MMP28 Antibody (3C11)

Sandwich ELISA: MMP28 Antibody (3C11) [H00079148-M01] - Detection limit for recombinant GST tagged MMP28 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3C11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

MMP28 Antibody (3C11) Summary

• Immunogen: MMP28 (NP_077278, 441 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LARGGLQVEPYYPRSLQDWGGIPEEVSGALPRPDGSIIFFRDDRYWRLDQAKLQATTSGRWATELPWMGCWHANSGSALF
• Specificity: MMP28 (3C11)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MMP28
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MMP28 Antibody (3C11)

• EC 3.4.24
• EC 3.4.24.-
• Epilysin
• matrix metallopeptidase 28
• matrix metalloproteinase 28
• MM28
• MMP25
• MMP28
• MMP-28
• MMP-28MMP-25
• putative MMP28 gene product

Background

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix for both normal physiological processes, such as embryonic development, reproduction and tissue remodeling, and disease processes, such as asthma and metastasis. This gene encodes a secreted enzyme that degrades casein. Its expression pattern suggests that it plays a role in tissue homeostasis and in wound repair. Transcript variants encoding different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MMP28
• Entrez:
  • 79148(Human)
• OMIM:
  • 608417(Human)
• Uniprot:
  • NP_077278()