MMP21 Antibody - BSA Free

Western Blot: MMP21 Antibody [NBP2-84165] - Host: Rabbit. Target Name: Mmp21. Sample Type: Mouse Liver lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MMP21 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MMP21 Antibody - BSA Free (NBP2-84165) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse MMP21. Peptide sequence: YIPQEPAFELDWADRKAIQRLYGSCKGSFDTVFDWIRKERNQYGEVRVR The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MMP21
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MMP21 Antibody - BSA Free

• EC 3.4.24
• EC 3.4.24.-
• matrix metallopeptidase 21
• matrix metalloproteinase 21
• matrix metalloproteinase-21
• MMP21
• MMP-21

Background

Matrix metalloproteinases (MMPs) play key roles in tissue remodelling under normal development and, especially, in diseases ranging from malignancies to stroke. Expression of MMP-21 is controlled uniquely by Pax and Notch transcription factors known to be critical for organogenesis. MMP-21 is expressed transiently in mouse embryogenesis and increased in embryonic neuronal tissues. Observations indicate that there is an important specific function for MMP-21 in embryogenesis, especially in neuronal cells (1). MMP-21 is expressed in various human fetal and adult tissues as well as in cancer cell lines. MMP-21 protein can also be detected in malignancies such as ovarian and colon carcinomas by immunohistochemical staining. Findings suggest that MMP-21 functions in embryogenesis and tumor progression (2). Results suggest that during development, MMP-21 expression is temporally and spatially tightly controlled. Unlike many classical MMPs, it is present in various normal adult tissues. Among epithelial MMPs, MMP-21 has a unique expression pattern in cancer (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MMP21