MMP-8 Antibody - BSA Free

Immunohistochemistry-Paraffin: MMP8 Antibody [NBP1-85576] - Staining of human spleen shows strong cytoplasmic positivity in cells of red pulp.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MMP-8 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MMP8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MMP-8 Protein (NBP1-85576PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MMP-8 Antibody - BSA Free

• CLG1HNC
• Collagenase 2
• EC 3.4.24
• EC 3.4.24.34
• matrix metallopeptidase 8 (neutrophil collagenase)
• matrix metalloproteinase 8 (neutrophil collagenase)
• Matrix metalloproteinase-8
• MMP8
• MMP-8
• neutrophil collagenase
• PMNL collagenase
• PMNL-CL

Background

MMP8 is a Metallopeptidase M10A type protease. MMP8 is a Metallopeptidase M10A type protease. It is synthesized and stored intracellularly in specific granules in neutrophils. MMP8 shows a preference for degrading type I collagen.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MMP-8 Antibody (NBP1-85576)(2)

Publications using NBP1-85576

• Ivano Legnini, Lisa Emmenegger, Alessandra Zappulo, Agnieszka Rybak-Wolf, Ricardo Wurmus, Anna Oliveras Martinez, Cledi Cerda Jara, Anastasiya Boltengagen, Talé Hessler, Guido Mastrobuoni, Stefan Kempa, Robert Zinzen, Andrew Woehler, Nikolaus Rajewsky Spatiotemporal, optogenetic control of gene expression in organoids Nature Methods 2023-09-21 [PMID: 37735569]
• Ong CW, Elkington PT, Brilha S et al. Neutrophil-Derived MMP-8 Drives AMPK-Dependent Matrix Destruction in Human Pulmonary Tuberculosis. PLoS Pathog. 2015-05-01 [PMID: 25996154] (Human)

Bioinformatics

• Gene Symbol: MMP8