MMP-8 Antibody


Immunohistochemistry-Paraffin: MMP8 Antibody [NBP1-85576] - Staining of human spleen shows strong cytoplasmic positivity in cells of red pulp.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

MMP-8 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:KWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNG
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MMP-8 Protein (NBP1-85576PEP)
Read Publication using NBP1-85576.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MMP-8 Antibody

  • Collagenase 2
  • EC 3.4.24
  • EC
  • matrix metallopeptidase 8 (neutrophil collagenase)
  • matrix metalloproteinase 8 (neutrophil collagenase)
  • Matrix metalloproteinase-8
  • MMP8
  • MMP-8
  • neutrophil collagenase
  • PMNL collagenase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)

Publications for MMP-8 Antibody (NBP1-85576)(1)

We have publications tested in 1 confirmed species: Human.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for MMP-8 Antibody (NBP1-85576) (0)

There are no reviews for MMP-8 Antibody (NBP1-85576). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MMP-8 Antibody (NBP1-85576) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MMP-8 Products

Bioinformatics Tool for MMP-8 Antibody (NBP1-85576)

Discover related pathways, diseases and genes to MMP-8 Antibody (NBP1-85576). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMP-8 Antibody (NBP1-85576)

Discover more about diseases related to MMP-8 Antibody (NBP1-85576).

Pathways for MMP-8 Antibody (NBP1-85576)

View related products by pathway.

PTMs for MMP-8 Antibody (NBP1-85576)

Learn more about PTMs related to MMP-8 Antibody (NBP1-85576).

Research Areas for MMP-8 Antibody (NBP1-85576)

Find related products by research area.

Blogs on MMP-8

There are no specific blogs for MMP-8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MMP-8 Antibody and receive a gift card or discount.


Gene Symbol MMP8