Immunocytochemistry/ Immunofluorescence: MMP-8 Antibody [NBP1-85576] - Neurophil MMP-8 associates with NETs. Neutrophils were infected with M.tb MOI of 10 for 4 hours and NETs stained with DAPI (blue), anti-histone 2B ...read more
Immunohistochemistry-Paraffin: MMP-8 Antibody [NBP1-85576] - Neutrophil MMP-8 and -9 are upregulated in human TB. Magnified H&E and MMP-8 stains from Fig 1C inset shows neutrophils immunoreactive for MMP-8 around the ...read more
Immunohistochemistry-Paraffin: MMP8 Antibody [NBP1-85576] - Staining of human spleen shows strong cytoplasmic positivity in cells of red pulp.
This antibody was developed against Recombinant Protein corresponding to amino acids: KWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MMP8
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
MMP8 is a Metallopeptidase M10A type protease. MMP8 is a Metallopeptidase M10A type protease. It is synthesized and stored intracellularly in specific granules in neutrophils. MMP8 shows a preference for degrading type I collagen.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our MMP-8 Antibody - BSA Free and receive a gift card or discount.