MLLT11 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MLLT11 Antibody [NBP2-14237] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: MLLT11 Antibody [NBP2-14237] - Staining of human cerebral cortex shows moderate cytoplasmic and nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MLLT11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEG DGLLEYSTFNFWRAPIASIHSFEL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MLLT11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MLLT11 Protein (NBP2-14237PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MLLT11 Antibody

  • AF1QRP11-316M1.10
  • ALL1 fused gene from chromosome 1q
  • ALL1-fused gene from chromosome 1q
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 11
  • protein AF1q

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF3996
Species: Hu
Applications: WB
H00000389-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00001646-M03
Species: Hu
Applications: WB, ELISA
NB100-56080
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-84891
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF

Publications for MLLT11 Antibody (NBP2-14237) (0)

There are no publications for MLLT11 Antibody (NBP2-14237).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MLLT11 Antibody (NBP2-14237) (0)

There are no reviews for MLLT11 Antibody (NBP2-14237). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MLLT11 Antibody (NBP2-14237) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MLLT11 Products

Bioinformatics Tool for MLLT11 Antibody (NBP2-14237)

Discover related pathways, diseases and genes to MLLT11 Antibody (NBP2-14237). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MLLT11 Antibody (NBP2-14237)

Discover more about diseases related to MLLT11 Antibody (NBP2-14237).
 

Pathways for MLLT11 Antibody (NBP2-14237)

View related products by pathway.

Research Areas for MLLT11 Antibody (NBP2-14237)

Find related products by research area.

Blogs on MLLT11

There are no specific blogs for MLLT11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MLLT11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MLLT11