MKLP1 Antibody (9V4Y8) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 801-960 of human MKLP1 (Q02241). NAPPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETLKQESPNGSRKRRSSTVAPAQPDGAESEWTDVETRCSVAVEMRAGSQLGPGYQHHAQPKRKKP |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
KIF23 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoprecipitation 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
- Western Blot 1:500 - 1:1000
|
| Theoretical MW |
110 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MKLP1 Antibody (9V4Y8)
Background
Using the CHO1 monoclonal antibody, Sellitto and Kuriyama (1988) identified a spindle antigen that was shown by Nislow et al. (1990) to be required for mitotic progression. By using the CHO1 antibody to screen a HeLa cell cDNA library, Nislow et al. (1992) isolated a KNSL5 cDNA, which they called MKLP1 (mitotic kinesin-like protein-1), that encodes this antigen. The N-terminal region of the deduced 961-amino acid protein contains a 350-residue domain that shares 30 to 45% identity with the motor domains of other members of the kinesin superfamily. The C-terminal region shows little identity with other kinesins. A central region contains heptad repeats of hydrophobic residues that may assemble into a coiled-coil structure similar to kinesin and myosin heavy chain proteins. The protein also contains a putative nuclear localization signal and 2 consensus phosphorylation sites characteristic of nuclear proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Ch, Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Dr, Hu, Ma, Mu, Pl, Po, Rt
Applications: IB, ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: WB, ELISA, IP
Publications for MKLP1 Antibody (NBP3-16507) (0)
There are no publications for MKLP1 Antibody (NBP3-16507).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MKLP1 Antibody (NBP3-16507) (0)
There are no reviews for MKLP1 Antibody (NBP3-16507).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MKLP1 Antibody (NBP3-16507) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MKLP1 Products
Research Areas for MKLP1 Antibody (NBP3-16507)
Find related products by research area.
|
Blogs on MKLP1