MKL2 Antibody (CL1546)

Images

 
Western Blot: MKL2 Antibody (CL1546) [NBP2-52970] - Lane 1: Marker [kDa], Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: MKL2 Antibody (CL1546) [NBP2-52970] - Staining of A549 cells using the Anti-MKL2 monoclonal antibody, showing specific staining in nuclear speckles and the cytosol in green. ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clone
CL1546
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MKL2 Antibody (CL1546) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QRPGPMELVEKNILPVDSSVKEAIIGVGKEDYPHTQGDFSFDEDSSDALSPDQPASQESQGSAASPSEPKVSESPSPVTTNTPAQFASVSPTVPEFLKTPPTADQPPPRPAAPVLPTNTVSSAKPGPALVKQSHPKNP
Epitope
FASVSPTVPEFLKTP
Specificity
Specificity of human MKL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
MKL2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MKL2 Recombinant Protein Antigen (NBP2-52970PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for MKL2 Antibody (CL1546)

  • DKFZp686J1745
  • FLJ31823
  • FLJ45623
  • KIAA1243
  • megakaryoblastic leukemia 2
  • MKL/myocardin-like 2
  • MKL/myocardin-like protein 2
  • MRTFB
  • MRTF-B
  • myocardin-related transcription factor B
  • NPD001

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88498
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4028
Species: Hu, Mu
Applications: WB
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55997
Species: Hu
Applications: ICC/IF
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-92248
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-89679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37602
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00081624-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-79505
Species: Hu
Applications: WB
NBP2-45545
Species: Hu
Applications: WB, IHC
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
NBP2-55275
Species: Hu
Applications: ICC/IF

Publications for MKL2 Antibody (NBP2-52970) (0)

There are no publications for MKL2 Antibody (NBP2-52970).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MKL2 Antibody (NBP2-52970) (0)

There are no reviews for MKL2 Antibody (NBP2-52970). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MKL2 Antibody (NBP2-52970) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for MKL2 Antibody (NBP2-52970)

Discover related pathways, diseases and genes to MKL2 Antibody (NBP2-52970). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MKL2 Antibody (NBP2-52970)

Discover more about diseases related to MKL2 Antibody (NBP2-52970).
 

Pathways for MKL2 Antibody (NBP2-52970)

View related products by pathway.

PTMs for MKL2 Antibody (NBP2-52970)

Learn more about PTMs related to MKL2 Antibody (NBP2-52970).

Blogs on MKL2

There are no specific blogs for MKL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MKL2 Antibody (CL1546) and receive a gift card or discount.

Bioinformatics

Gene Symbol MKL2