MIXL1 Recombinant Protein Antigen

Images

 
There are currently no images for MIXL1 Recombinant Protein Antigen (NBP2-55175PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MIXL1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MIXL1.

Source: E. coli

Amino Acid Sequence: RKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEPNGVGGGISDSSSQGQNFETCSPLSEDIGSKLDSWEEHIFSA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MIXL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55175.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MIXL1 Recombinant Protein Antigen

  • hMix
  • homeobox protein MIXL1
  • Homeodomain protein MIX
  • MGC138179
  • MILD1
  • Mix.1 homeobox-like protein
  • Mix1 homeobox (Xenopus laevis)-like 1
  • Mix1 homeobox-like 1 (Xenopus laevis)
  • MIX1 homeobox-like protein 1
  • MIXL1
  • Mix-like homeobox protein 1
  • MIXLMIX

Background

MIXL1, also known as Homeobox protein MIXL1, is a 232 amino acid protein that is 25 kDa, restricted to progenitors and secondary lymph tissues, acts as an important transcription factor in proper axial mesendoderm morphogenesis and endoderm formation, needed for efficient differentiation of cells from the primitive streak stage to blood by acting early in the recruitment and/or expansion of mesodermal progenitors to the hemangioblastic and hematopoietic lineages, participates in the morphogenesis of the heart and the gut during embryogenesis, and acts as a negative regulator of brachyury expression. Studies of this protein are being performed on research about uterine inversion, vascular dementia, Hodgkin's lymphoma, dementia, cholera, and hematopoiesis. OMA1 protein has been shown to interact with ALX4, DLX1, GTF2E1, IRF9, NEUROD1, NKX2-1, POU4F2, and TLE6 proteins in adipogenesis pathway and endoderm formation, hematopoietic progenitor cell differentiation, transcription, DNA-dependent, gastrulation, endoderm development, heart development, and digestive tract development processes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-30475
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP2-46076
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
314-BP
Species: Hu
Applications: BA, BA
M6000B
Species: Mu
Applications: ELISA
NBP2-38770
Species: Hu, Mu
Applications:  IHC-P, WB
AF4086
Species: Hu
Applications: ICC, WB
3218-ND
Species: Hu
Applications: BA
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
AF2400
Species: Hu
Applications: ChIP, ICC, IHC, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
2914-HT
Species: Hu
Applications: BA
MAB1368
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
DTM100
Species: Hu
Applications: ELISA
NBP3-12242
Species: Ch, Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB

Publications for MIXL1 Recombinant Protein Antigen (NBP2-55175PEP) (0)

There are no publications for MIXL1 Recombinant Protein Antigen (NBP2-55175PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MIXL1 Recombinant Protein Antigen (NBP2-55175PEP) (0)

There are no reviews for MIXL1 Recombinant Protein Antigen (NBP2-55175PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MIXL1 Recombinant Protein Antigen (NBP2-55175PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MIXL1 Products

Array NBP2-55175PEP

Research Areas for MIXL1 Recombinant Protein Antigen (NBP2-55175PEP)

Find related products by research area.

Blogs on MIXL1

There are no specific blogs for MIXL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MIXL1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MIXL1