MIXL1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MIXL1. Source: E. coli Amino Acid Sequence: RKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEPNGVGGGISDSSSQGQNFETCSPLSEDIGSKLDSWEEHIFSA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
MIXL1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55175. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
34 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for MIXL1 Recombinant Protein Antigen
Background
MIXL1, also known as Homeobox protein MIXL1, is a 232 amino acid protein that is 25 kDa, restricted to progenitors and secondary lymph tissues, acts as an important transcription factor in proper axial mesendoderm morphogenesis and endoderm formation, needed for efficient differentiation of cells from the primitive streak stage to blood by acting early in the recruitment and/or expansion of mesodermal progenitors to the hemangioblastic and hematopoietic lineages, participates in the morphogenesis of the heart and the gut during embryogenesis, and acts as a negative regulator of brachyury expression. Studies of this protein are being performed on research about uterine inversion, vascular dementia, Hodgkin's lymphoma, dementia, cholera, and hematopoiesis. OMA1 protein has been shown to interact with ALX4, DLX1, GTF2E1, IRF9, NEUROD1, NKX2-1, POU4F2, and TLE6 proteins in adipogenesis pathway and endoderm formation, hematopoietic progenitor cell differentiation, transcription, DNA-dependent, gastrulation, endoderm development, heart development, and digestive tract development processes.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA, BA
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ChIP, ICC, IHC, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Ch, Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Publications for MIXL1 Recombinant Protein Antigen (NBP2-55175PEP) (0)
There are no publications for MIXL1 Recombinant Protein Antigen (NBP2-55175PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MIXL1 Recombinant Protein Antigen (NBP2-55175PEP) (0)
There are no reviews for MIXL1 Recombinant Protein Antigen (NBP2-55175PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for MIXL1 Recombinant Protein Antigen (NBP2-55175PEP) (0)
Additional MIXL1 Products
Research Areas for MIXL1 Recombinant Protein Antigen (NBP2-55175PEP)
Find related products by research area.
|
Blogs on MIXL1