Recombinant Human MIXL1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MIXL1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 86-185 of Human MIXL1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QRRKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MIXL1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MIXL1 Protein

  • hMix
  • homeobox protein MIXL1
  • Homeodomain protein MIX
  • MGC138179
  • MILD1
  • Mix.1 homeobox-like protein
  • Mix1 homeobox (Xenopus laevis)-like 1
  • Mix1 homeobox-like 1 (Xenopus laevis)
  • MIX1 homeobox-like protein 1
  • MIXL1
  • Mix-like homeobox protein 1
  • MIXLMIX

Background

MIXL1 - Mix1 homeobox-like 1 (Xenopus laevis)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-46076
Species: Hu
Applications: WB, IHC
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-47790
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2400
Species: Hu
Applications: WB, ChIP, ICC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
AF2085
Species: Hu, Mu
Applications: WB, IHC, ChIP, ICC
NBP1-46183
Species: Hu
Applications: WB, IP
H00083881-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for MIXL1 Partial Recombinant Protein (H00083881-Q01) (0)

There are no publications for MIXL1 Partial Recombinant Protein (H00083881-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MIXL1 Partial Recombinant Protein (H00083881-Q01) (0)

There are no reviews for MIXL1 Partial Recombinant Protein (H00083881-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MIXL1 Partial Recombinant Protein (H00083881-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MIXL1 Products

Bioinformatics Tool for MIXL1 Partial Recombinant Protein (H00083881-Q01)

Discover related pathways, diseases and genes to MIXL1 Partial Recombinant Protein (H00083881-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MIXL1 Partial Recombinant Protein (H00083881-Q01)

Discover more about diseases related to MIXL1 Partial Recombinant Protein (H00083881-Q01).
 

Pathways for MIXL1 Partial Recombinant Protein (H00083881-Q01)

View related products by pathway.

PTMs for MIXL1 Partial Recombinant Protein (H00083881-Q01)

Learn more about PTMs related to MIXL1 Partial Recombinant Protein (H00083881-Q01).

Blogs on MIXL1

There are no specific blogs for MIXL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MIXL1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MIXL1
Entrez