Mitochondrial fission regulator 1 Antibody


Western Blot: Mitochondrial fission regulator 1 Antibody [NBP2-55309] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: Mitochondrial fission regulator 1 Antibody [NBP2-55309] - Staining of human cell line A-431 shows localization to cytosol & mitochondria.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF

Order Details

Mitochondrial fission regulator 1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GLHQSTSAVDLIKERREKRANAGKTLVKNNPKKPEMPNMLEILKEMNSVKLRSVKRSEQDV
Specificity of human Mitochondrial fission regulator 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Mitochondrial fission regulator 1 Recombinant Protein Antigen (NBP2-55309PEP)

Reactivity Notes

Mouse 80%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for Mitochondrial fission regulator 1 Antibody

  • Chondrocyte protein with a poly-proline region
  • mitochondrial fission regulator 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, ChHa, Dr, Fu, Pl, Pr, Rb, Sh, Xp, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Species: Hu
Applications: WB, ICC/IF

Publications for Mitochondrial fission regulator 1 Antibody (NBP2-55309) (0)

There are no publications for Mitochondrial fission regulator 1 Antibody (NBP2-55309).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mitochondrial fission regulator 1 Antibody (NBP2-55309) (0)

There are no reviews for Mitochondrial fission regulator 1 Antibody (NBP2-55309). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Mitochondrial fission regulator 1 Antibody (NBP2-55309) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Mitochondrial fission regulator 1 Products

Bioinformatics Tool for Mitochondrial fission regulator 1 Antibody (NBP2-55309)

Discover related pathways, diseases and genes to Mitochondrial fission regulator 1 Antibody (NBP2-55309). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mitochondrial fission regulator 1 Antibody (NBP2-55309)

Discover more about diseases related to Mitochondrial fission regulator 1 Antibody (NBP2-55309).

Pathways for Mitochondrial fission regulator 1 Antibody (NBP2-55309)

View related products by pathway.

PTMs for Mitochondrial fission regulator 1 Antibody (NBP2-55309)

Learn more about PTMs related to Mitochondrial fission regulator 1 Antibody (NBP2-55309).

Blogs on Mitochondrial fission regulator 1

There are no specific blogs for Mitochondrial fission regulator 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Mitochondrial fission regulator 1 Antibody and receive a gift card or discount.


Gene Symbol MTFR1