MiRP3 Antibody

Images

 
Western Blot: MiRP3 Antibody [NBP1-81049] - Analysis in control (vector only transfected HEK293T lysate) and KCNE4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: MiRP3 Antibody [NBP1-81049] - Staining of human cell line BJ shows localization to nuclear bodies & microtubules. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MiRP3 Antibody [NBP1-81049] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MiRP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EKKSSLLLLYKDEERLWGEAMKPLPVVSGLRSVQVPLMLNMLQESVAPALSCTLCSMEGDSVSSESSSPDVHLTIQEEGADDELEETSETPLNESSEGSSEN
Specificity
Specificity of human MiRP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNE4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MiRP3 Protein (NBP1-81049PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MiRP3 Antibody

  • cardiac voltage-gated potassium channel accessory subunit 4
  • MGC20353
  • Minimum potassium ion channel-related peptide 3
  • MinK-related peptide 3
  • MiRP3
  • Potassium channel subunit beta MiRP3
  • potassium voltage-gated channel subfamily E member 4
  • potassium voltage-gated channel, Isk-related family, member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12897
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
H00003753-M01
Species: Hu, Rt, Ca, Gp, Pm
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA
NBP1-49885
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-85835
Species: Hu
Applications: IHC, IHC-P
NBP2-38146
Species: Hu
Applications: IHC, IHC-P
H00030819-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, RNAi
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1892
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP3-03109
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-76945
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00003738-M01
Species: Hu
Applications: WB, ELISA, S-ELISA
NBP2-84125
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67375
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-52497
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NBP2-12900
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, MiAr
NBP2-80429
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-81049
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MiRP3 Antibody (NBP1-81049) (0)

There are no publications for MiRP3 Antibody (NBP1-81049).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MiRP3 Antibody (NBP1-81049) (0)

There are no reviews for MiRP3 Antibody (NBP1-81049). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MiRP3 Antibody (NBP1-81049) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MiRP3 Products

Bioinformatics Tool for MiRP3 Antibody (NBP1-81049)

Discover related pathways, diseases and genes to MiRP3 Antibody (NBP1-81049). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MiRP3 Antibody (NBP1-81049)

Discover more about diseases related to MiRP3 Antibody (NBP1-81049).
 

Pathways for MiRP3 Antibody (NBP1-81049)

View related products by pathway.

PTMs for MiRP3 Antibody (NBP1-81049)

Learn more about PTMs related to MiRP3 Antibody (NBP1-81049).

Blogs on MiRP3

There are no specific blogs for MiRP3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MiRP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNE4
Entrez