MIR16 Antibody

Images

 
Western Blot: MIR16 Antibody [NBP1-69654] - This Anti-GDE1 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 0.5ug/ml.
Immunohistochemistry: MIR16 Antibody [NBP1-69654] - Staining of human Liver.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MIR16 Antibody Summary

Immunogen
Synthetic peptides corresponding to GDE1 The peptide sequence was selected from the N terminal of GDE1. Peptide sequence LRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKN.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GDE1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against GDE1 and was validated on Western Blot and immunohistochemistry-Paraffin.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MIR16 Antibody

  • EC 3.1.4.44
  • glycerophosphodiester phosphodiesterase 1
  • membrane interacting protein of RGS16
  • Membrane-interacting protein of RGS16
  • MIR16363E6.2
  • RGS16-interacting membrane protein

Background

GDE1 has glycerophosphoinositol phosphodiesterase activity. It has little or no activity towards glycerophosphocholine. GDE1 activity can be modulated by G-protein signaling pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01584
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
H00002166-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-83711
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP1-06520
Species: Hu, Mu
Applications: WB, IP
640-A3
Species: Mu
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-80070
Species: Hu, Mu, Rt, Fu
Applications: WB, ICC/IF
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-15343
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41268
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-37957
Species: Hu
Applications: IHC, IHC-P
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NB100-2817
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP1-88032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MIR16 Antibody (NBP1-69654) (0)

There are no publications for MIR16 Antibody (NBP1-69654).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MIR16 Antibody (NBP1-69654) (0)

There are no reviews for MIR16 Antibody (NBP1-69654). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MIR16 Antibody (NBP1-69654) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MIR16 Products

Bioinformatics Tool for MIR16 Antibody (NBP1-69654)

Discover related pathways, diseases and genes to MIR16 Antibody (NBP1-69654). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MIR16 Antibody (NBP1-69654)

Discover more about diseases related to MIR16 Antibody (NBP1-69654).
 

Pathways for MIR16 Antibody (NBP1-69654)

View related products by pathway.

Blogs on MIR16

There are no specific blogs for MIR16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MIR16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GDE1
Uniprot