MIR16 Antibody

Western Blot: MIR16 Antibody [NBP1-69654] - This Anti-GDE1 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 0.5ug/ml.

Immunohistochemistry: MIR16 Antibody [NBP1-69654] - Staining of human Liver.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

MIR16 Antibody Summary

• Immunogen: Synthetic peptides corresponding to GDE1 The peptide sequence was selected from the N terminal of GDE1. Peptide sequence LRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKN. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GDE1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against GDE1 and was validated on Western Blot and immunohistochemistry-Paraffin .

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MIR16 Antibody

• EC 3.1.4.44
• glycerophosphodiester phosphodiesterase 1
• membrane interacting protein of RGS16
• Membrane-interacting protein of RGS16
• MIR16363E6.2
• RGS16-interacting membrane protein

Background

GDE1 has glycerophosphoinositol phosphodiesterase activity. It has little or no activity towards glycerophosphocholine. GDE1 activity can be modulated by G-protein signaling pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GDE1
• Uniprot:
  • Q9NZC3(Human)