MIR16 Antibody


Western Blot: MIR16 Antibody [NBP1-69654] - This Anti-GDE1 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 0.5ug/ml.
Immunohistochemistry: MIR16 Antibody [NBP1-69654] - Staining of human Liver.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

MIR16 Antibody Summary

Synthetic peptides corresponding to GDE1 The peptide sequence was selected from the N terminal of GDE1. Peptide sequence LRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKN.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against GDE1 and was validated on Western Blot and immunohistochemistry-Paraffin.
Positive Control
MIR16 Lysate (NBP2-65377)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MIR16 Antibody

  • EC
  • glycerophosphodiester phosphodiesterase 1
  • membrane interacting protein of RGS16
  • Membrane-interacting protein of RGS16
  • MIR16363E6.2
  • RGS16-interacting membrane protein


GDE1 has glycerophosphoinositol phosphodiesterase activity. It has little or no activity towards glycerophosphocholine. GDE1 activity can be modulated by G-protein signaling pathways.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Eq, Pm
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Mu
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Fu
Applications: WB, ICC/IF
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MIR16 Antibody (NBP1-69654) (0)

There are no publications for MIR16 Antibody (NBP1-69654).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MIR16 Antibody (NBP1-69654) (0)

There are no reviews for MIR16 Antibody (NBP1-69654). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MIR16 Antibody (NBP1-69654) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional MIR16 Products

Bioinformatics Tool for MIR16 Antibody (NBP1-69654)

Discover related pathways, diseases and genes to MIR16 Antibody (NBP1-69654). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MIR16 Antibody (NBP1-69654)

Discover more about diseases related to MIR16 Antibody (NBP1-69654).

Pathways for MIR16 Antibody (NBP1-69654)

View related products by pathway.

Blogs on MIR16

There are no specific blogs for MIR16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MIR16 Antibody and receive a gift card or discount.


Gene Symbol GDE1