ABHD4 Antibody

Images

 
Western Blot: ABHD4 Antibody [NBP1-83711] - Analysis in control (vector only transfected HEK293T lysate) and ABHD4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: ABHD4 Antibody [NBP1-83711] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ABHD4 Antibody [NBP1-83711] - Staining of human cerebellum shows moderate cytoplasmic positivity in purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABHD4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSLPNQNKIWTVTVSPEQNDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGAEDEFVTSIETWRETMGIPSMILLGHSLGGF
Specificity
Specificity of human ABHD4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABHD4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ABHD4 Protein (NBP1-83711PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ABHD4 Antibody

  • ABH4
  • abhydrolase domain containing 4
  • abhydrolase domain-containing protein 4
  • Alpha/beta-hydrolase 4
  • EC 3.1.1.-
  • FLJ12816
  • Lyso-N-acylphosphatidylethanolamine lipase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-80070
Species: Hu, Mu, Rt, Fu
Applications: WB, ICC/IF
AF4886
Species: Mu
Applications: WB, IP
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-19809
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS32
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Mk, Pm
Applications: ICC/IF, IHC, IHC-P
NB300-606
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBL1-10416
Species: Hu
NBP2-00735
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00008846-B01P
Species: Hu
Applications: WB, ICC/IF, IHC-P
H00002166-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA
MAB3428
Species: Hu
Applications: WB, IHC
NB110-68136
Species: Hu, Mu, Rt, Fe
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF6457
Species: Hu
Applications: WB

Publications for ABHD4 Antibody (NBP1-83711) (0)

There are no publications for ABHD4 Antibody (NBP1-83711).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABHD4 Antibody (NBP1-83711) (0)

There are no reviews for ABHD4 Antibody (NBP1-83711). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ABHD4 Antibody (NBP1-83711) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ABHD4 Antibody (NBP1-83711)

Discover related pathways, diseases and genes to ABHD4 Antibody (NBP1-83711). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABHD4 Antibody (NBP1-83711)

Discover more about diseases related to ABHD4 Antibody (NBP1-83711).
 

Pathways for ABHD4 Antibody (NBP1-83711)

View related products by pathway.

PTMs for ABHD4 Antibody (NBP1-83711)

Learn more about PTMs related to ABHD4 Antibody (NBP1-83711).
 

Research Areas for ABHD4 Antibody (NBP1-83711)

Find related products by research area.

Blogs on ABHD4

There are no specific blogs for ABHD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABHD4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABHD4