MIOX Antibody

Images

 
Western Blot: MIOX Antibody [NBP2-31975] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry: MIOX Antibody [NBP2-31975] - Immunohistochemical staining of human kidney shows moderate cytoplasmic and nuclear positivity in renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MIOX Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PEAFYMIRFHSFYPWHTGRDYQQLCSQQDLAMLPWVREFNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCPGI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MIOX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MIOX Protein (NBP2-31975PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MIOX Antibody

  • aldehyde reductase (aldose reductase) like 6
  • Aldehyde reductase-like 6
  • ALDRL6
  • inositol oxygenase
  • Kidney-specific protein 32
  • KSP32
  • MGC90217
  • MI oxygenase
  • myo-inositol oxygenaseEC 1.13.99.1
  • Renal-specific oxidoreductase
  • RSOR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-90233
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000126-D01P
Species: Hu, Mu
Applications: WB
NBP2-00649
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-45335
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00000130-M01
Species: Hu
Applications: WB, ELISA
NBP2-20799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for MIOX Antibody (NBP2-31975) (0)

There are no publications for MIOX Antibody (NBP2-31975).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MIOX Antibody (NBP2-31975) (0)

There are no reviews for MIOX Antibody (NBP2-31975). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MIOX Antibody (NBP2-31975) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MIOX Products

Bioinformatics Tool for MIOX Antibody (NBP2-31975)

Discover related pathways, diseases and genes to MIOX Antibody (NBP2-31975). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MIOX Antibody (NBP2-31975)

Discover more about diseases related to MIOX Antibody (NBP2-31975).
 

Pathways for MIOX Antibody (NBP2-31975)

View related products by pathway.

PTMs for MIOX Antibody (NBP2-31975)

Learn more about PTMs related to MIOX Antibody (NBP2-31975).

Blogs on MIOX

There are no specific blogs for MIOX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MIOX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MIOX
Uniprot