Mind Bomb 2/MIB2 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Mind Bomb 2/MIB2 Antibody - BSA Free (NBP2-57751) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYMHNKHELAHAFDRYETAHSRPVTLSPRQGLPRIPLRGIFQ |
| Predicted Species |
Mouse (93%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MIB2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Mind Bomb 2/MIB2 Antibody - BSA Free
Background
MIB2/Skeletrophin is an actin-binding protein that bears two MIB/HERC2 domains, a ZZ-type zinc-finger domain, nine ankyrin repeats, and two RING-finger domains. The C-terminal RING domain has been found to have E3 ubiquitin ligase activity that mediates ubiquitination of the intracellular regions of the Notch receptor and its ligands to regulate Notch signaling. MIB2/Skeletrophin appears to be important to muscle development and may function as a suppressor of melanoma invasion.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IHC, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Pm
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu, Pm
Applications: IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: B/N, Func-Inh, In vitro, In vivo
Publications for Mind Bomb 2/MIB2 Antibody (NBP2-57751) (0)
There are no publications for Mind Bomb 2/MIB2 Antibody (NBP2-57751).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Mind Bomb 2/MIB2 Antibody (NBP2-57751) (0)
There are no reviews for Mind Bomb 2/MIB2 Antibody (NBP2-57751).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Mind Bomb 2/MIB2 Antibody (NBP2-57751) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Mind Bomb 2/MIB2 Products
Research Areas for Mind Bomb 2/MIB2 Antibody (NBP2-57751)
Find related products by research area.
|
Blogs on Mind Bomb 2/MIB2