Mind Bomb 2/MIB2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Mind Bomb 2/MIB2 Antibody [NBP2-57751] - Staining of human skeletal muscle shows high expression.

Immunohistochemistry-Paraffin: Mind Bomb 2/MIB2 Antibody [NBP2-57751] - Staining of human heart muscle shows low expression as expected.

Immunohistochemistry-Paraffin: Mind Bomb 2/MIB2 Antibody [NBP2-57751] - Staining in human skeletal muscle and heart muscle tissues using anti-MIB2 antibody. Corresponding MIB2 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Mind Bomb 2/MIB2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Mind Bomb 2/MIB2 Antibody - BSA Free (NBP2-57751) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYMHNKHELAHAFDRYETAHSRPVTLSPRQGLPRIPLRGIFQ
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MIB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Mind Bomb 2/MIB2 Recombinant Protein Antigen (NBP2-57751PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Mind Bomb 2/MIB2 Antibody - BSA Free

• E3 ubiquitin-protein ligase MIB2
• EC 6.3.2
• EC 6.3.2.-
• EC 6.3.2.13
• FLJ20648
• FLJ41406
• MIB2
• Mind Bomb 2
• Mind bomb homolog 2
• Mind Bomb-2
• mindbomb homolog 2 (Drosophila)
• Novel zinc finger protein
• Novelzin
• Putative NF-kappa-B-activating protein 002N
• SKD
• Skeletrophin
• Zinc finger ZZ type with ankyrin repeat domain protein 1
• ZZ type with ankyrin repeat domain 1
• ZZANK1
• ZZZ5

Background

MIB2/Skeletrophin is an actin-binding protein that bears two MIB/HERC2 domains, a ZZ-type zinc-finger domain, nine ankyrin repeats, and two RING-finger domains. The C-terminal RING domain has been found to have E3 ubiquitin ligase activity that mediates ubiquitination of the intracellular regions of the Notch receptor and its ligands to regulate Notch signaling. MIB2/Skeletrophin appears to be important to muscle development and may function as a suppressor of melanoma invasion.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MIB2