Mind Bomb 1/MIB1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Mind Bomb 1/MIB1 Antibody [NBP1-85210] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear membrane, plasma membrane & vesicles.
Immunohistochemistry-Paraffin: Mind Bomb 1/MIB1 Antibody [NBP1-85210] - Staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Mind Bomb 1/MIB1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MIB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Mind Bomb 1/MIB1 Protein (NBP1-85210PEP)
Publications
Read Publication using NBP1-85210.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Mind Bomb 1/MIB1 Antibody

  • DAPK-interacting protein 1
  • DIP1
  • DIP-1FLJ90676
  • DKFZp686I0769
  • DKFZp761M1710
  • E3 ubiquitin-protein ligase MIB1
  • EC 6.3.2
  • EC 6.3.2.-
  • KIAA1323
  • MGC129660
  • MIB
  • MIB1
  • Mind Bomb 1
  • Mind bomb homolog 1
  • mindbomb homolog 1 (Drosophila)
  • ubiquitin ligase mind bomb
  • ubiquitin ligase protein MIB1
  • Zinc finger ZZ type with ankyrin repeat domain protein 2
  • ZZANK2
  • ZZANK2MGC129659
  • ZZZ6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-07799
Species: Hu
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1844
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85210
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Mind Bomb 1/MIB1 Antibody (NBP1-85210)(1)

Reviews for Mind Bomb 1/MIB1 Antibody (NBP1-85210) (0)

There are no reviews for Mind Bomb 1/MIB1 Antibody (NBP1-85210). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Mind Bomb 1/MIB1 Antibody (NBP1-85210) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Mind Bomb 1/MIB1 Products

Bioinformatics Tool for Mind Bomb 1/MIB1 Antibody (NBP1-85210)

Discover related pathways, diseases and genes to Mind Bomb 1/MIB1 Antibody (NBP1-85210). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mind Bomb 1/MIB1 Antibody (NBP1-85210)

Discover more about diseases related to Mind Bomb 1/MIB1 Antibody (NBP1-85210).
 

Pathways for Mind Bomb 1/MIB1 Antibody (NBP1-85210)

View related products by pathway.

PTMs for Mind Bomb 1/MIB1 Antibody (NBP1-85210)

Learn more about PTMs related to Mind Bomb 1/MIB1 Antibody (NBP1-85210).
 

Research Areas for Mind Bomb 1/MIB1 Antibody (NBP1-85210)

Find related products by research area.

Blogs on Mind Bomb 1/MIB1

There are no specific blogs for Mind Bomb 1/MIB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Mind Bomb 1/MIB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MIB1
Entrez