MGST3 Antibody

Images

 
Western Blot: MGST3 Antibody [H00004259-D01P] - Analysis of MGST3 expression in human liver.
Western Blot: MGST3 Antibody [H00004259-D01P] - Analysis of MGST3 expression in K-562.
Western Blot: MGST3 Antibody [H00004259-D01P] - Analysis of MGST3 expression in transfected 293T cell line by MGST3 polyclonal antibody.Lane 1: MGST3 transfected lysate(16.50 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MGST3 Antibody Summary

Immunogen
MGST3 (NP_004519.1, 1 a.a. - 152 a.a.) full-length human protein. MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLGLVGTTVCSAFQHLGWVKSGLGSGPKCCH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MGST3
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MGST3 Antibody

  • EC 2.5.1.18
  • GST-III
  • microsomal glutathione S-transferase 3
  • microsomal glutathione S-transferase III
  • Microsomal GST-3
  • Microsomal GST-III

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69315
Species: Hu
Applications: WB
NBP1-82653
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-891
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NBP1-47829
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IP
NBP1-87852
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
H00002948-T01
Species: Hu
NBP1-83323
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00004259-D01P
Species: Hu
Applications: WB

Publications for MGST3 Antibody (H00004259-D01P) (0)

There are no publications for MGST3 Antibody (H00004259-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MGST3 Antibody (H00004259-D01P) (0)

There are no reviews for MGST3 Antibody (H00004259-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MGST3 Antibody (H00004259-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MGST3 Products

Bioinformatics Tool for MGST3 Antibody (H00004259-D01P)

Discover related pathways, diseases and genes to MGST3 Antibody (H00004259-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MGST3 Antibody (H00004259-D01P)

Discover more about diseases related to MGST3 Antibody (H00004259-D01P).
 

Pathways for MGST3 Antibody (H00004259-D01P)

View related products by pathway.

PTMs for MGST3 Antibody (H00004259-D01P)

Learn more about PTMs related to MGST3 Antibody (H00004259-D01P).

Blogs on MGST3

There are no specific blogs for MGST3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MGST3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MGST3
Uniprot