mGluR2 Antibody (3H7)

Sandwich ELISA: mGluR2 Antibody (3H7) [H00002912-M03] - Detection limit for recombinant GST tagged GRM2 is approximately 0.3ng/ml as a capture antibody.

Product Discontinued

mGluR2 Antibody (3H7) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: GRM2 (NP_000830, 414 a.a. ~ 506 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NGRRLYKDFVLNVKFDAPFRPADTHNEVRFDRFGDGIGRYNIFTYLRAGSGRYRYQKVGYWAEGLTLDTSLIPWASPSAGPLAASRCSEPCLQ
• Specificity: glutamate receptor, metabotropic 2
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GRM2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
• Application Notes: Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for mGluR2 Antibody (3H7)

• GLUR2
• glutamate metabotropic receptor 2
• glutamate receptor, metabotropic 2
• GPRC1B
• GPRC1Bmetabotropic glutamate receptor 2
• GRM2
• mGlu2
• mGluR2
• MGLUR2glutamate receptor homolog
• mGluR7

Background

L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GRM2
• Entrez:
  • 2912(Human)
• OMIM:
  • 604099(Human)
• Uniprot:
  • NP_000830()