MgcRacGAP/RACGAP1 Antibody (10F7U6) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MgcRacGAP/RACGAP1 (Q9H0H5). MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQI |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
RACGAP1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MgcRacGAP/RACGAP1 Antibody (10F7U6)
Background
Rho GTPases control a variety of cellular processes. There are 3 subtypes of Rho GTPases in the Ras superfamily of small G proteins: RHO (see MIM 165370), RAC (see RAC1; MIM 602048), and CDC42 (MIM 116952). GTPase-activating proteins (GAPs) bind activated forms of Rho GTPases and stimulate GTP hydrolysis. Through this catalytic function, Rho GAPs negatively regulate Rho-mediated signals. GAPs may also serve as effector molecules and play a role in signaling downstream of Rho and other Ras-like GTPases.[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, Â IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, Â IHC-P, WB
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, Â IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, Â IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, Â IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, Â IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, Â IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, Â IHC-P, IP, MiAr, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, Â IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, Â IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, Â IHC-P, IP, MiAr, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, Â IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
Publications for MgcRacGAP/RACGAP1 Antibody (NBP3-15700) (0)
There are no publications for MgcRacGAP/RACGAP1 Antibody (NBP3-15700).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MgcRacGAP/RACGAP1 Antibody (NBP3-15700) (0)
There are no reviews for MgcRacGAP/RACGAP1 Antibody (NBP3-15700).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MgcRacGAP/RACGAP1 Antibody (NBP3-15700) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MgcRacGAP/RACGAP1 Products
Research Areas for MgcRacGAP/RACGAP1 Antibody (NBP3-15700)
Find related products by research area.
|
Blogs on MgcRacGAP/RACGAP1