MGAT4B Antibody

Images

 
Immunohistochemistry-Paraffin: MGAT4B Antibody [NBP2-14236] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MGAT4B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VVDVYQREFLALRDRLHAAEQESLKRSKELNLVLDEIKRAVSERQALRDG DGNRTWGRLTEDPRLKPWNGSHRHVLHLPTVFHHLPHLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MGAT4B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MGAT4B Protein (NBP2-14236PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MGAT4B Antibody

  • alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B
  • alpha-1,3-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase
  • aminyltransferase
  • EC 2.4.1.145
  • GlcNAc-T IVb
  • GNT-IV
  • GNT-IVB
  • isoenzyme B
  • isozyme B
  • mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase
  • N-acetylglucosaminyltransferase IVb
  • N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb
  • UDP-N-acetylglucosamine: alpha-1,3-D-mannosidebeta-1,4-N-acetylglucosaminyltransferase IV
  • UDP-N-acetylglucosamine: alpha-1,3-D-mannosidebeta-1,4-N-acetylglucosaminyltransferase IVb

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81809
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-46466
Species: Hu
Applications: IHC
MAB5469
Species: Hu
Applications: WB, ICC
NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-14236
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for MGAT4B Antibody (NBP2-14236) (0)

There are no publications for MGAT4B Antibody (NBP2-14236).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MGAT4B Antibody (NBP2-14236) (0)

There are no reviews for MGAT4B Antibody (NBP2-14236). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MGAT4B Antibody (NBP2-14236) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MGAT4B Products

Bioinformatics Tool for MGAT4B Antibody (NBP2-14236)

Discover related pathways, diseases and genes to MGAT4B Antibody (NBP2-14236). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MGAT4B Antibody (NBP2-14236)

Discover more about diseases related to MGAT4B Antibody (NBP2-14236).

PTMs for MGAT4B Antibody (NBP2-14236)

Learn more about PTMs related to MGAT4B Antibody (NBP2-14236).
 

Research Areas for MGAT4B Antibody (NBP2-14236)

Find related products by research area.

Blogs on MGAT4B

There are no specific blogs for MGAT4B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MGAT4B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MGAT4B