MGAT4B Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit MGAT4B Antibody - BSA Free (NBP2-14236) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: VVDVYQREFLALRDRLHAAEQESLKRSKELNLVLDEIKRAVSERQALRDGDGNRTWGRLTEDPRLKPWNGSHRHVLHLPTVFHHLPHLL |
| Predicted Species |
Mouse (96%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MGAT4B |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for MGAT4B Antibody - BSA Free
Background
MGAT4B, also known as Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B, has 3 isoforms, a 548 amino acid isoform that is 63 kDa, a 547 amino acid isoform that is 63 kDa, and a 563 amino acid isoform that is 65 kDa; participates in the transfer of N-acetylglucosamine (GlcNAc) to the core mannose residues of N-linked glycans; acts as a catalyzer in the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans; necessary for the production of tri- and tetra-antennary N-linked sugar chains, and it is not the main contributor in N-glycan biosynthesis. Disease research is currently being performed with relation to MGAT4B and immunodeficiency, pancreatic cancer, hepatocellular carcinoma, pancreatitis, interferon, carcinoma, and extrahepatic bile duct carcinoma. Interactions with this protein have been shown to involve LRSAM1, MGAT2, MGAT3, MGAT5, FUT8, and MGAT5B in N-glycan antennae elongation in the medial/trans-Golgi, transport to the Golgi and subsequent modification, asparagine N-linked glycosylation, N-Glycan antennae elongation, methabolism of proteins, N-Glycan biosynthesis, and metabolic pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Publications for MGAT4B Antibody (NBP2-14236) (0)
There are no publications for MGAT4B Antibody (NBP2-14236).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MGAT4B Antibody (NBP2-14236) (0)
There are no reviews for MGAT4B Antibody (NBP2-14236).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for MGAT4B Antibody (NBP2-14236) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MGAT4B Products
Research Areas for MGAT4B Antibody (NBP2-14236)
Find related products by research area.
|
Blogs on MGAT4B