Methionine Sulfoxide Reductase A Antibody - BSA Free

Immunohistochemistry-Paraffin: Methionine Sulfoxide Reductase A Antibody [NBP3-17739] - Staining of human small intestine shows strong nuclear and cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Methionine Sulfoxide Reductase A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Methionine Sulfoxide Reductase A Antibody - BSA Free (NBP3-17739) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSTIYPTS
• Predicted Species: Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MSRA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Methionine Sulfoxide Reductase A Antibody - BSA Free

• cytosolic methionine-S-sulfoxide reductase
• EC 1.8.4.11
• methionine sulfoxide reductase A
• peptide met (O) reductase
• Peptide Met(O) reductase
• peptide methionine sulfoxide reductase
• Peptide-methionine (S)-S-oxide reductase
• PMSR
• Protein-methionine-S-oxide reductase

Background

This protein is ubiquitous and highly conserved. It carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. Its proposed function is the repair of oxidative damage to proteins to restore biological activity. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MSRA