Methionine Sulfoxide Reductase A Antibody - BSA Free

Western Blot: Methionine Sulfoxide Reductase A Antibody [NBP1-57727] - Human Lung lysate, concentration 0.2-1 ug/ml.

Immunohistochemistry: Methionine Sulfoxide Reductase A Antibody [NBP1-57727] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Methionine Sulfoxide Reductase A Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to MSRA (methionine sulfoxide reductase A) The peptide sequence was selected from the middle region of MSRA)(50ug). Peptide sequence YQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MSRA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Methionine Sulfoxide Reductase A Antibody - BSA Free

• cytosolic methionine-S-sulfoxide reductase
• EC 1.8.4.11
• methionine sulfoxide reductase A
• peptide met (O) reductase
• Peptide Met(O) reductase
• peptide methionine sulfoxide reductase
• Peptide-methionine (S)-S-oxide reductase
• PMSR
• Protein-methionine-S-oxide reductase

Background

This protein is ubiquitous and highly conserved. It carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. Its proposed function is the repair of oxidative damage to proteins to restore biological activity. Three transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Methionine Sulfoxide Reductase A Antibody (NBP1-57727)(1)

Publication using NBP1-57727

• Zhong G, He Y, Wan F, et al. Effects of Long-Term Exposure to Copper on the Keap1/Nrf2 Signaling Pathway and Msr-Related Redox Status in the Kidneys of Rats Biological trace element research 2021-01-22 [PMID: 33479888]

Bioinformatics

• Gene Symbol: MSRA
• Uniprot:
  • Q9UJ68(Human)