Mesothelin Antibody (1A10)

Images

 
Immunoprecipitation: Mesothelin Antibody (1A10) [H00010232-M02] - Analysis of MSLN transfected lysate using anti-MSLN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MSLN MaxPab rabbit polyclonal ...read more
ELISA: Mesothelin Antibody (1A10) [H00010232-M02] - Detection limit for recombinant GST tagged MSLN is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
1A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Mesothelin Antibody (1A10) Summary

Immunogen
MSLN (NP_005814, 464 a.a. ~ 563 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DLDTCDPRQLDVLYPKARLAFQNMNGSEYFVKIQSFLGGAPTEDLKALSQQNVSMDLATFMKLRTDAVLPLTVAEVQKLLGPHVEGLKAEERHRPVRDWI
Specificity
MSLN (1A10)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MSLN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunoprecipitation 1:10-1:500
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Mesothelin Antibody (1A10)

  • CAK1 antigen
  • CAK1
  • megakaryocyte potentiating factor
  • Mesothelin
  • MPF
  • MPFSMRP
  • MSLN
  • Pre-pro-megakaryocyte-potentiating factor
  • SMR
  • soluble MPF mesothelin related protein

Background

An antibody that reacts with ovarian cancers and mesotheliomas was used to isolate a cell surface antigen named mesothelin. Although the function of mesothelin is unknown, it may play a role in cellular adhesion and is present on mesothelium, mesotheliomas, and ovarian cancers. This gene encodes a preproprotein that is cleaved into two products, megakaryocyte potentiating factor and mesothelin. Alternative splicing results in multiple transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-33466
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF6000
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NBP1-86241
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-45184
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-89147
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-14243
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
5609-MU
Species: Hu
Applications: Bind
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
7954-GM/CF
Species: Hu
Applications: BA
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-67719
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
288-TPN/CF
Species: Hu
Applications: BA
NBP1-87905
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00010232-M02
Species: Hu
Applications: WB, ELISA, IP

Publications for Mesothelin Antibody (H00010232-M02) (0)

There are no publications for Mesothelin Antibody (H00010232-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mesothelin Antibody (H00010232-M02) (0)

There are no reviews for Mesothelin Antibody (H00010232-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mesothelin Antibody (H00010232-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Mesothelin Products

Bioinformatics Tool for Mesothelin Antibody (H00010232-M02)

Discover related pathways, diseases and genes to Mesothelin Antibody (H00010232-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mesothelin Antibody (H00010232-M02)

Discover more about diseases related to Mesothelin Antibody (H00010232-M02).
 

Pathways for Mesothelin Antibody (H00010232-M02)

View related products by pathway.

PTMs for Mesothelin Antibody (H00010232-M02)

Learn more about PTMs related to Mesothelin Antibody (H00010232-M02).
 

Research Areas for Mesothelin Antibody (H00010232-M02)

Find related products by research area.

Blogs on Mesothelin

There are no specific blogs for Mesothelin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Mesothelin Antibody (1A10) and receive a gift card or discount.

Bioinformatics

Gene Symbol MSLN
Entrez
OMIM
Uniprot