MEPE/OF45 Antibody

Images

 
Immunohistochemistry: MEPE Antibody [NBP2-32652] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry: MEPE Antibody [NBP2-32652] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MEPE/OF45 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: REENGGNTIGTRDETAKEADAVDVSLVEGSNDIMGSTNFKELPGREGNRVDAGSQNAHQGKVEFHYPPAPSKEKRKEGSSDAAESTNYNEIPK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MEPE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MEPE/OF45 Protein (NBP2-32652PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MEPE/OF45 Antibody

  • extracellular phosphoglycoprotein with ASARM motif (bone)
  • matrix extracellular phosphoglycoprotein
  • MEPE
  • OF45
  • Osteoregulin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

2629-FG/CF
Species: Mu
NBP1-45525
Species: Hu, Mu, Rt
Applications: WB
46780002
Species: Hu
Applications: ELISA
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
8090-ZN
Species: Hu
H00009988-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-35213
Species: Hu
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
1827-SF/CF
Species: Hu
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NB100-56630
Species: Hu
Applications: WB
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
355-BM/CF
Species: Hu, Mu, Rt
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-32652
Species: Hu
Applications: IHC, IHC-P

Publications for MEPE/OF45 Antibody (NBP2-32652) (0)

There are no publications for MEPE/OF45 Antibody (NBP2-32652).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEPE/OF45 Antibody (NBP2-32652) (0)

There are no reviews for MEPE/OF45 Antibody (NBP2-32652). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MEPE/OF45 Antibody (NBP2-32652) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MEPE/OF45 Products

Bioinformatics Tool for MEPE/OF45 Antibody (NBP2-32652)

Discover related pathways, diseases and genes to MEPE/OF45 Antibody (NBP2-32652). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEPE/OF45 Antibody (NBP2-32652)

Discover more about diseases related to MEPE/OF45 Antibody (NBP2-32652).
 

Pathways for MEPE/OF45 Antibody (NBP2-32652)

View related products by pathway.

PTMs for MEPE/OF45 Antibody (NBP2-32652)

Learn more about PTMs related to MEPE/OF45 Antibody (NBP2-32652).

Blogs on MEPE/OF45

There are no specific blogs for MEPE/OF45, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEPE/OF45 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MEPE
Entrez