Melanotransferrin/CD228/MFI2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Melanotransferrin/CD228/MFI2 Antibody [NBP1-85777] - Analysis in human salivary gland and skeletal muscle tissues. Corresponding MELTF RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Melanotransferrin/CD228/MFI2 Antibody [NBP1-85777] - Staining of human malignant melanoma shows moderate membranous positivity in tumor cells.

Immunohistochemistry-Paraffin: Melanotransferrin/CD228/MFI2 Antibody [NBP1-85777] - Staining of human skin shows weak to moderate cytoplasmic positivity in keratinocytes.

Immunohistochemistry-Paraffin: Melanotransferrin/CD228/MFI2 Antibody [NBP1-85777] - Staining of human salivary gland shows moderate to strong positivity in luminal membrane in glandular cells.

Immunohistochemistry-Paraffin: Melanotransferrin/CD228/MFI2 Antibody [NBP1-85777] - Staining of human kidney shows moderate to strong membranous positivity in cells in glomeruli.

Immunohistochemistry-Paraffin: Melanotransferrin/CD228/MFI2 Antibody [NBP1-85777] - Staining of human skeletal muscle shows no positivity in myocytes.

Analysis in human cell lines SK-MEL-30 and HeLa using Anti-MELTF antibody. Corresponding MELTF RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Melanotransferrin/CD228/MFI2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Melanotransferrin/CD228/MFI2 Antibody - BSA Free (NBP1-85777) is a polyclonal antibody validated for use in IHC and WB. Anti-Melanotransferrin/CD228/MFI2 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RSEDYELLCPNGARAEVSQFAACNLAQIPPHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFKMFDSSNYHGQDLLFKDATVRAVPVGEKTTYRGWLGLDYVAALEGMSSQQC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MELTF
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Melanotransferrin/CD228/MFI2 Protein (NBP1-85777PEP)

Reactivity Notes

Mouse (87%), Rat (86%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Melanotransferrin/CD228/MFI2 Antibody - BSA Free

• antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and96.5
• CD228 antigen
• CD228
• FLJ38863
• MAP97
• MAP97Melanoma-associated antigen p97
• Melanotransferrin
• membrane-bound transferrin-like protein
• MFI2
• MGC4856
• MTF
• MTF1
• p97

Background

MFI2 is encoded by this gene is a cell-surface glycoprotein found on melanoma cells. The protein shares sequence similarity and iron-binding properties with members of the transferrin superfamily. The importance of the iron binding function has not yet been identified. This gene resides in the same region of chromosome 3 as members of the transferrin superfamily. Alternative splicing results in two transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Melanotransferrin/CD228/MFI2 Antibody (NBP1-85777)(3)

Publications using NBP1-85777

• Yen WC, Chang KP, Chen CY et al. MFI2 upregulation promotes malignant progression through EGF/FAK signaling in oral cavity squamous cell carcinoma Cancer cell international 2023-06-12 [PMID: 37309001] (Western Blot, Human)
• Jandova J, Park SL, Corenblum MJ et al. Mefloquine induces ER stress and apoptosis in BRAFi-resistant A375-BRAFV600E /NRASQ61K malignant melanoma cells targeting intracranial tumors in a bioluminescent murine model Molecular carcinogenesis 2022-04-13 [PMID: 35417045]
• Sawaki K, Kanda M, Umeda S et al. Level of Melanotransferrin in Tissue and Sera Serves as a Prognostic Marker of Gastric Cancer Anticancer Res. 2019-11-01 [PMID: 31704840] (Human)

Bioinformatics

• Gene Symbol: MELTF