MEI1 Antibody

Images

 
Immunohistochemistry-Paraffin: MEI1 Antibody [NBP2-14229] - Staining of human testis shows strong cytoplasmic and nuclear positivity in subset of cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MEI1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HMKEKFSKKLASSSFIRLTLELKARFCSGLSHSALNQVCSNFLYYMCLNL LSAPEKTGPPSKEELSAVSELLQHGLPQISSRS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MEI1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MEI1 Protein (NBP2-14229PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MEI1 Antibody

  • meiosis defective 1
  • Meiosis defective protein 1
  • meiosis inhibitor 1
  • meiosis inhibitor protein 1
  • MGC40042

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58172
Species: Hu
Applications: WB
NB100-181
Species: Hu, Mu
Applications: WB, IP
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-02667
Species: Hu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56552
Species: Hu
Applications: WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-89966
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP1-57487
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90335
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
AF5510
Species: Hu
Applications: WB
NBP2-37583
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-217
Species: Hu, Mu
Applications: WB, IP, PLA
NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010472-D01P
Species: Hu
Applications: WB, ELISA

Publications for MEI1 Antibody (NBP2-14229) (0)

There are no publications for MEI1 Antibody (NBP2-14229).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEI1 Antibody (NBP2-14229) (0)

There are no reviews for MEI1 Antibody (NBP2-14229). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MEI1 Antibody (NBP2-14229) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MEI1 Products

Bioinformatics Tool for MEI1 Antibody (NBP2-14229)

Discover related pathways, diseases and genes to MEI1 Antibody (NBP2-14229). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEI1 Antibody (NBP2-14229)

Discover more about diseases related to MEI1 Antibody (NBP2-14229).
 

Pathways for MEI1 Antibody (NBP2-14229)

View related products by pathway.

PTMs for MEI1 Antibody (NBP2-14229)

Learn more about PTMs related to MEI1 Antibody (NBP2-14229).

Blogs on MEI1

There are no specific blogs for MEI1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEI1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MEI1