MEGF9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MEGF9 Antibody [NBP2-55631] - Staining of human cell line A549 shows localization to nucleoplasm & cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MEGF9 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SELEPECDQCKDGYIGPNCNKCENGYYNFDSICRKCQCHGHVDPVKTPKICKPESGECINCLHNTTGFWCENCLEGYVHDLEGNCIKKEVILPTPEGSTILVSNASLTTSVPTPVINSTFTPTTLQTIFSVST
Specificity
Specificity of human MEGF9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MEGF9
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Mouse 86%, Rat 84%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MEGF9 Antibody

  • EGFL5
  • EGFL5KIAA0818
  • EGF-like protein 5
  • EGF-like-domain, multiple 5
  • Epidermal growth factor-like protein 5
  • MEGF9
  • Multiple EGF-like domains protein 9
  • multiple EGF-like-domains 9
  • multiple epidermal growth factor-like domains protein 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56170
Species: Hu, Bv, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-56977
Species: Hu, Mu, Rt, Ca, Eq, GP, Rb
Applications: WB, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
NBP1-88561
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3025
Species: Hu
Applications: WB, ELISA, ICC
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00026147-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-00955
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89314
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71662
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24762
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-76932
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC
NBP1-81473
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31558
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-67484
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00011065-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-57150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for MEGF9 Antibody (NBP2-55631) (0)

There are no publications for MEGF9 Antibody (NBP2-55631).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEGF9 Antibody (NBP2-55631) (0)

There are no reviews for MEGF9 Antibody (NBP2-55631). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MEGF9 Antibody (NBP2-55631) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MEGF9 Products

Array NBP2-55631

Bioinformatics Tool for MEGF9 Antibody (NBP2-55631)

Discover related pathways, diseases and genes to MEGF9 Antibody (NBP2-55631). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEGF9 Antibody (NBP2-55631)

Discover more about diseases related to MEGF9 Antibody (NBP2-55631).
 

Pathways for MEGF9 Antibody (NBP2-55631)

View related products by pathway.

PTMs for MEGF9 Antibody (NBP2-55631)

Learn more about PTMs related to MEGF9 Antibody (NBP2-55631).

Blogs on MEGF9

There are no specific blogs for MEGF9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEGF9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MEGF9