MEGF9 Antibody - BSA Free

Immunohistochemistry-Paraffin: MEGF9 Antibody [NBP1-84886] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: MEGF9 Antibody [NBP1-84886] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Immunohistochemistry-Paraffin: MEGF9 Antibody [NBP1-84886] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: MEGF9 Antibody [NBP1-84886] - Staining of human lung shows strong cytoplasmic/ membranous positivity in macrophages.

Immunohistochemistry-Paraffin: MEGF9 Antibody [NBP1-84886] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: MEGF9 Antibody [NBP1-84886] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MEGF9 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YQNRKLNAPFWTIELKEDNISFSSYHDSIPNADVSGLLEDDGNEVAPNGQLTLT
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MEGF9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MEGF9 Protein (NBP1-84886PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MEGF9 Antibody - BSA Free

• EGFL5
• EGFL5KIAA0818
• EGF-like protein 5
• EGF-like-domain, multiple 5
• Epidermal growth factor-like protein 5
• MEGF9
• Multiple EGF-like domains protein 9
• multiple EGF-like-domains 9
• multiple epidermal growth factor-like domains protein 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MEGF9