MEFV Antibody (4E6)

Images

 
Sandwich ELISA: MEFV Antibody (4E6) [H00004210-M01] - Detection limit for recombinant GST tagged MEFV is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4E6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MEFV Antibody (4E6) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
MEFV (NP_000234, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAKTPSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSRIPRSQIQRARPVKMATLLVTYYGEEYAVQLTLQVLRAINQRLLAEELHRAAIQEYSTQENGTDDSAASSSL
Specificity
MEFV - Mediterranean fever
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MEFV
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MEFV Antibody (4E6)

  • FMF
  • FMFmarenostrin
  • Marenostrin
  • Mediterranean fever
  • MEFpyrin
  • MGC126560
  • MGC126586
  • TRIM20

Background

This gene encodes a protein, also known as pyrin or marenostrin, that is an important modulator of innate immunity. Mutations in this gene are associated with Mediterranean fever, a hereditary periodic fever syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
NBP1-78977
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IM, IP, Simple Western, WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NB100-56565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
DY1707
Species: Hu
Applications: ELISA
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
DRT100
Species: Hu
Applications: ELISA
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP3-23927
Species: Hu
Applications: IHC-P
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
M6000B
Species: Mu
Applications: ELISA
MAB1230
Species: Hu, Mu, Rt
Applications: ICC, IHC, KO, Simple Western, WB
H00004210-M01
Species: Hu
Applications: WB, ELISA

Publications for MEFV Antibody (H00004210-M01) (0)

There are no publications for MEFV Antibody (H00004210-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEFV Antibody (H00004210-M01) (0)

There are no reviews for MEFV Antibody (H00004210-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MEFV Antibody (H00004210-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MEFV Products

Diseases for MEFV Antibody (H00004210-M01)

Discover more about diseases related to MEFV Antibody (H00004210-M01).
 

Pathways for MEFV Antibody (H00004210-M01)

View related products by pathway.

PTMs for MEFV Antibody (H00004210-M01)

Learn more about PTMs related to MEFV Antibody (H00004210-M01).
 

Research Areas for MEFV Antibody (H00004210-M01)

Find related products by research area.

Blogs on MEFV

There are no specific blogs for MEFV, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEFV Antibody (4E6) and receive a gift card or discount.

Bioinformatics

Gene Symbol MEFV
Entrez
Uniprot