MED30 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MED30 Antibody [NBP2-58363] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MED30 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTY
Specificity
Specificity of human MED30 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MED30
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MED30 Recombinant Protein Antigen (NBP2-58363PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MED30 Antibody

  • mediator complex subunit 30TRAP/Mediator complex component TRAP25
  • mediator of RNA polymerase II transcription subunit 30
  • putative mediator of RNA polymerase II transcription subunit 30
  • THRAP6MGC9890
  • thyroid hormone receptor associated protein 6
  • Thyroid hormone receptor-associated protein 6
  • Thyroid hormone receptor-associated protein complex 25 kDa component
  • Trap25
  • TRAP25MED30S

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-84177
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85161
Species: Hu
Applications: IHC, IHC-P
NBP2-92796
Species: Hu, Mu
Applications: WB, IHC
NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, IP, ChIP
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
AF5520
Species: Hu, Mu
Applications: WB
NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, CHIP-SEQ, KD
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, S-ELISA
NBP1-81319
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
NBP1-88145
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91189
Species: Hu, Mu(-)
Applications: WB (-), ICC/IF, IHC, IHC-P
H00079075-B01P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, MiAr
NBP2-38188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74599
Species: Hu, Mu
Applications: WB, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
AF1334
Species: Hu
Applications: WB, IHC

Publications for MED30 Antibody (NBP2-58363) (0)

There are no publications for MED30 Antibody (NBP2-58363).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED30 Antibody (NBP2-58363) (0)

There are no reviews for MED30 Antibody (NBP2-58363). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MED30 Antibody (NBP2-58363) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MED30 Products

Bioinformatics Tool for MED30 Antibody (NBP2-58363)

Discover related pathways, diseases and genes to MED30 Antibody (NBP2-58363). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED30 Antibody (NBP2-58363)

Discover more about diseases related to MED30 Antibody (NBP2-58363).
 

Pathways for MED30 Antibody (NBP2-58363)

View related products by pathway.

Research Areas for MED30 Antibody (NBP2-58363)

Find related products by research area.

Blogs on MED30

There are no specific blogs for MED30, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MED30 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MED30