MED17 Recombinant Protein Antigen

Images

 
There are currently no images for MED17 Recombinant Protein Antigen (NBP3-17737PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MED17 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MED17

Source: E. coli

Amino Acid Sequence: IGVEQIRVVHRDGRVITLSYQEQELQDFLLSQMSQHQVHAVQQLAKVMGWQVLSFSNHVGLGPIESIGNASAITVASPSGDYAISVRNGPESGSKIMVQFPRNQCKDLPKSDVLQDNKWSHLRGPFKEVQWNKMEGRN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MED17
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17737.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MED17 Recombinant Protein Antigen

  • Activator-recruited cofactor 77 kDa component
  • Cofactor required for Sp1 transcriptional activation subunit 6
  • cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa
  • CRSP6FLJ10812
  • CRSP77cofactor required for Sp1 transcriptional activation, subunit 6 (77kD)
  • DRIP77
  • DRIP80ARC77
  • mediator complex subunit 17Vitamin D3 receptor-interacting protein complex 80 kDa component
  • mediator of RNA polymerase II transcription subunit 17
  • Thyroid hormone receptor-associated protein complex 80 kDa component
  • Transcriptional coactivator CRSP77
  • Trap80
  • TRAP80CRSP complex subunit 6

Background

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2574
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, KD, WB
NBP3-05055
Species: Hu, Mu, Rt
Applications: WB
NBP1-91189
Species: Hu, Mu(-)
Applications: ICC/IF, IHC,  IHC-P, WB (-)
H00001024-M03
Species: Hu, Mu, Rt
Applications: ELISA, WB
NB100-2357
Species: Hu, Mu, Pm
Applications: ChIP, IHC,  IHC-P, IP, WB
NBP2-38118
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-89014
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NB200-338
Species: Hu, Mu
Applications: IP, WB (-)
H00009443-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
NBP3-13787
Species: Hu
Applications: ELISA, Flow, ICC/IF, IP, PA, WB
H00000054-D01P
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB600-507
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, PEP-ELISA, WB
DCDL40
Species: Hu
Applications: ELISA
NBP2-34162
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00057410-M02
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
NBP1-87315
Species: Hu
Applications: IHC,  IHC-P
NB100-74599
Species: Hu, Mu
Applications: IP, WB
NBP1-87029
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB

Publications for MED17 Recombinant Protein Antigen (NBP3-17737PEP) (0)

There are no publications for MED17 Recombinant Protein Antigen (NBP3-17737PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED17 Recombinant Protein Antigen (NBP3-17737PEP) (0)

There are no reviews for MED17 Recombinant Protein Antigen (NBP3-17737PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MED17 Recombinant Protein Antigen (NBP3-17737PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MED17 Products

Research Areas for MED17 Recombinant Protein Antigen (NBP3-17737PEP)

Find related products by research area.

Blogs on MED17

There are no specific blogs for MED17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MED17 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MED17