MED10 Antibody

Images

 
Western Blot: MED10 Antibody [NBP2-58707] - Western blot analysis in control (vector only transfected HEK293T lysate) and MED10 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunocytochemistry/ Immunofluorescence: MED10 Antibody [NBP2-58707] - Staining of human cell line HeLa shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MED10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVP
Specificity
Specificity of human MED10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MED10
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MED10 Recombinant Protein Antigen (NBP2-58707PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MED10 Antibody

  • L6
  • mediator complex subunit 10TRG-17
  • mediator of RNA polymerase II transcription subunit 10
  • mediator of RNA polymerase II transcription, subunit 10 homolog (NUT2, S.cerevisiae)
  • mediator of RNA polymerase II transcription, subunit 10
  • MGC5309
  • NUT2TRG-20
  • Transformation-related gene 17 protein
  • Transformation-related gene 20 protein
  • TRG20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00058516-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP2-45435
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81332
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84537
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80104
Species: Hu
Applications: WB
NB100-2269
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MED10 Antibody (NBP2-58707) (0)

There are no publications for MED10 Antibody (NBP2-58707).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED10 Antibody (NBP2-58707) (0)

There are no reviews for MED10 Antibody (NBP2-58707). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MED10 Antibody (NBP2-58707) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for MED10 Antibody (NBP2-58707)

Discover related pathways, diseases and genes to MED10 Antibody (NBP2-58707). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED10 Antibody (NBP2-58707)

Discover more about diseases related to MED10 Antibody (NBP2-58707).
 

Pathways for MED10 Antibody (NBP2-58707)

View related products by pathway.

Blogs on MED10

There are no specific blogs for MED10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MED10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MED10