MEA-1 Antibody

Immunocytochemistry/Immunofluorescence: MEA-1 Antibody [NBP1-81245] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MEA-1 Antibody [NBP1-81245] - Staining of human testis shows cytoplasmic positivity in seminiferus ducts.

Western blot analysis in control (vector only transfected HEK293T lysate) and MEA1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Product Discontinued

MEA-1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ALNNHSSIPMDPEHVELVKRTMAGVSLPAPGVPAWAREISDAQWEDVVQKALQARQAS
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MEA1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MEA-1 Antibody

• HYS
• Male-enhanced antigen (H-Y structural gene)
• male-enhanced antigen 1
• male-enhanced antigen
• MEA1
• MEA-1
• MEAMEA-1

Background

MEA1 may play an important role in spermatogenesis and/or testis development

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MEA1