ME1 Antibody (3H5)

Images

 
Western Blot: ME1 Antibody (3H5) [H00004199-M03] - Analysis of ME1 expression in transfected 293T cell line by ME1 monoclonal antibody (M03), clone 3H5. Lane 1: ME1 transfected lysatE (64.1 KDa). Lane 2: Non-transfected ...read more
Immunohistochemistry-Paraffin: ME1 Antibody (3H5) [H00004199-M03] - Analysis of monoclonal antibody to ME1 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 0.5 ug/ml
Western Blot: ME1 Antibody (3H5) [H00004199-M03] - Analysis of ME1 expression in HepG2 (Cat # L019V1).
Sandwich ELISA: ME1 Antibody (3H5) [H00004199-M03] - Detection limit for recombinant GST tagged ME1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
3H5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ME1 Antibody (3H5) Summary

Immunogen
ME1 (AAH25246, 1 a.a. ~ 572 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQ
Specificity
ME1 - malic enzyme 1, NADP(+)-dependent, cytosolic
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ME1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Publications
Read Publications using H00004199-M03.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ME1 Antibody (3H5)

  • EC 1.1.1
  • EC 1.1.1.40
  • HUMNDME
  • malate dehydrogenase
  • Malic enzyme 1
  • malic enzyme 1, NADP(+)-dependent, cytosolic
  • malic enzyme 1, soluble
  • Malic enzyme, cytoplasmic
  • MES
  • NADP-dependent malic enzyme
  • NADP-ME
  • pyruvic-malic carboxylase

Background

This gene encodes a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IP
NBP2-45880
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IF
NBP2-02541
Species: Hu, Mu, Rt, Pm, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67344
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75610
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-80533
Species: Hu, Mu
Applications: WB
NBP1-54825
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89515
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02164
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
H00004199-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for ME1 Antibody (H00004199-M03)(2)


Showing Publications 1 - 2 of 2.
Publications using H00004199-M03 Applications Species
Heart E, Cline GW, Collis LP et al. Role for malic enzyme, pyruvate carboxylation mitochondrial malate import in the glucose-stimulated insulin secretion. Am J Physiol Endocrinol Metab. 2009 Mar 17. [PMID: 19293334]
Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018

Reviews for ME1 Antibody (H00004199-M03) (0)

There are no reviews for ME1 Antibody (H00004199-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ME1 Antibody (H00004199-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ME1 Products

Array H00004199-M03

Bioinformatics Tool for ME1 Antibody (H00004199-M03)

Discover related pathways, diseases and genes to ME1 Antibody (H00004199-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ME1 Antibody (H00004199-M03)

Discover more about diseases related to ME1 Antibody (H00004199-M03).
 

Pathways for ME1 Antibody (H00004199-M03)

View related products by pathway.

PTMs for ME1 Antibody (H00004199-M03)

Learn more about PTMs related to ME1 Antibody (H00004199-M03).

Blogs on ME1

There are no specific blogs for ME1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ME1 Antibody (3H5) and receive a gift card or discount.

Bioinformatics

Gene Symbol ME1
Entrez
OMIM
Uniprot