Recombinant Human MDR1/ABCB1 GST (N-Term) Protein

Images

 
Recombinant Human MDR1/ABCB1 Protein [H00005243-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP, NULL

Order Details

Recombinant Human MDR1/ABCB1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 620-709 of Human MDR1/ABCB1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ABCB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Quantification
  • Western Blot
Theoretical MW
35.64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00005243-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MDR1/ABCB1 GST (N-Term) Protein

  • ABC20
  • ABCB1
  • ABCB1B
  • ATP-binding cassette sub-family B member 1
  • ATP-binding cassette, sub-family B (MDR/TAP), member 1
  • CD243 antigen
  • CD243
  • CLCS
  • colchicin sensitivity
  • doxorubicin resistance
  • EC 3.6.3
  • EC 3.6.3.44
  • GP170
  • IBD13
  • MDR1
  • MDR1MGC163296
  • multidrug resistance protein 1
  • P-glycoprotein 1
  • P-gp
  • PGY1
  • PGY1P-GP

Background

ABCB1 - ATP-binding cassette, sub-family B (MDR/TAP), member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
NBP2-22124
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-69023
Species: Mu
Applications: WB
NBP3-24587
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-556
Species: Hu
Applications: IP, WB
NBP2-37502
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-46186
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
AF6278
Species: Hu, Mu
Applications: WB
NBP1-82820
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-76670
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-30876
Species: Hu
Applications: IHC,  IHC-P
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NBP1-68885
Species: Hu
Applications: IHC, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-64808
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, WB

Publications for MDR1/ABCB1 Partial Recombinant Protein (H00005243-Q01)(1)

Reviews for MDR1/ABCB1 Partial Recombinant Protein (H00005243-Q01) (0)

There are no reviews for MDR1/ABCB1 Partial Recombinant Protein (H00005243-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MDR1/ABCB1 Partial Recombinant Protein (H00005243-Q01). (Showing 1 - 2 of 2 FAQ).

  1. I am interested in MDR1 Partial Recombinant Protein (H00005243-Q01). I've noticed that this protein is partialy recombinant. Please explain what means partialy. I would also like to know if the protein is folded correctly, since the data sheet says that it shouldn't be used for experiments requiring activity. Would you be so kind and let me know, which part of MDR1 protein is partial recombinant protein you have, is it the domain which is located on the exterior surface of plasma mambrane?
    • A parital recombinant protein is made from only a part of the DNA sequence where as a Recombinant protein is made from a full DNA sequence. This protein is produced by a Taiwanese company called Abnova. It is folded correctly however we have listed it to be biologically inactive due to many customer purchasing this from Abnova and finding that it does not function correctly therefore we have suggested not to use this for any experiments requiring activity. Amino acids 620 - 709 are in the partial recombinant protein and the domain on the exterior surface has not been specified.
  2. I have purchased H00005243-Q01, mdr1/abcb1 purified recombinant protein. The photo indicates a KDa of around 40. Do you have the exact KDa of this product? Usually the Kda of MDR1 is 170. I am using it as a positive control in western blot and I am not getting any bands.
    • I am sorry to learn that you used this partial recombinant protein in your WB as the positive control but did not yield any positive signal. I anticipate that your anti-human MDR1/ABCB1 antibody must bind to somewhere outside of 620 a.a. to 710 a.a. This partial protein contains only a part of the gene for human MDR1/ABCB1 (NP_000918, 620 a.a. - 710 a.a.) that is in-frame fused to a gene for the GST tag (~26 kDa) at its N-terminus. Therefore the apparent size for this partial protein is about 36 kDa, which is similar to that in the SDS-PAGE image posting on our webpage. According to "Uniprot Site", human MDR1/ABCB1 has two isoforms: isoform 1 has 1,280 a.a. with the calculated size of 141,479 Da, whereas isoform 2 has 1,216 a.a. (Mass in Da:134,032); and this is consistent with your information about the size of the protein. In summary this protein is apparently not suitable for your WB experiments as the positive control, unfortunately. The anti-human MDR1/ABCB1 antibody(ies) has to have the immunogen that is included in 620 a.a. to 710 a.a. in order for H00005243-Q01 to be useful as the positive control in WB.

Additional MDR1/ABCB1 Products

Research Areas for MDR1/ABCB1 Partial Recombinant Protein (H00005243-Q01)

Find related products by research area.

Blogs on MDR1/ABCB1

There are no specific blogs for MDR1/ABCB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MDR1/ABCB1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCB1