Recombinant Human MDR1/ABCB1 GST (N-Term) Protein Summary
Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 620-709 of Human MDR1/ABCB1 Source: Wheat Germ (in vitro) Amino Acid Sequence: GIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWP |
Preparation Method |
in vitro wheat germ expression system |
Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
Source |
Wheat germ |
Protein/Peptide Type |
Recombinant Protein |
Gene |
ABCB1 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Quantification
- Western Blot
|
Theoretical MW |
35.64 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Publications |
|
Packaging, Storage & Formulations
Storage |
Store at -80C. Avoid freeze-thaw cycles. |
Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human MDR1/ABCB1 GST (N-Term) Protein
Background
ABCB1 - ATP-binding cassette, sub-family B (MDR/TAP), member 1
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: DirELISA, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, WB
Publications for MDR1/ABCB1 Partial Recombinant Protein (H00005243-Q01)(1)
Showing Publication 1 -
1 of 1.
Reviews for MDR1/ABCB1 Partial Recombinant Protein (H00005243-Q01) (0)
There are no reviews for MDR1/ABCB1 Partial Recombinant Protein (H00005243-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MDR1/ABCB1 Partial Recombinant Protein (H00005243-Q01). (Showing 1 - 2 of 2 FAQ).
-
I am interested in MDR1 Partial Recombinant Protein (H00005243-Q01). I've noticed that this protein is partialy recombinant. Please explain what means partialy. I would also like to know if the protein is folded correctly, since the data sheet says that it shouldn't be used for experiments requiring activity. Would you be so kind and let me know, which part of MDR1 protein is partial recombinant protein you have, is it the domain which is located on the exterior surface of plasma mambrane?
- A parital recombinant protein is made from only a part of the DNA sequence where as a Recombinant protein is made from a full DNA sequence. This protein is produced by a Taiwanese company called Abnova. It is folded correctly however we have listed it to be biologically inactive due to many customer purchasing this from Abnova and finding that it does not function correctly therefore we have suggested not to use this for any experiments requiring activity. Amino acids 620 - 709 are in the partial recombinant protein and the domain on the exterior surface has not been specified.
-
I have purchased H00005243-Q01, mdr1/abcb1 purified recombinant protein. The photo indicates a KDa of around 40. Do you have the exact KDa of this product? Usually the Kda of MDR1 is 170. I am using it as a positive control in western blot and I am not getting any bands.
- I am sorry to learn that you used this partial recombinant protein in your WB as the positive control but did not yield any positive signal. I anticipate that your anti-human MDR1/ABCB1 antibody must bind to somewhere outside of 620 a.a. to 710 a.a. This partial protein contains only a part of the gene for human MDR1/ABCB1 (NP_000918, 620 a.a. - 710 a.a.) that is in-frame fused to a gene for the GST tag (~26 kDa) at its N-terminus. Therefore the apparent size for this partial protein is about 36 kDa, which is similar to that in the SDS-PAGE image posting on our webpage. According to "Uniprot Site", human MDR1/ABCB1 has two isoforms: isoform 1 has 1,280 a.a. with the calculated size of 141,479 Da, whereas isoform 2 has 1,216 a.a. (Mass in Da:134,032); and this is consistent with your information about the size of the protein. In summary this protein is apparently not suitable for your WB experiments as the positive control, unfortunately. The anti-human MDR1/ABCB1 antibody(ies) has to have the immunogen that is included in 620 a.a. to 710 a.a. in order for H00005243-Q01 to be useful as the positive control in WB.
Additional MDR1/ABCB1 Products
Research Areas for MDR1/ABCB1 Partial Recombinant Protein (H00005243-Q01)
Find related products by research area.
|
Blogs on MDR1/ABCB1