Recombinant Human MDMX Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MDMX Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 381-490 of Human MDMX

Source: Wheat Germ

Amino Acid Sequence: ENSKLFDPCNSVEFLDLAHSSESQETISSMGEQLDNLSEQRTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFIA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MDM4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MDMX Protein

  • DKFZp781B1423
  • double minute 4 homolog
  • Double minute 4 protein
  • double minute 4, human homolog of; p53-binding protein
  • HDMX
  • Mdm2-like p53-binding protein
  • Mdm4 p53 binding protein homolog (mouse)
  • Mdm4, transformed 3T3 cell double minute 4, p53 binding protein (mouse)
  • Mdm4, transformed 3T3 cell double minute 4, p53 binding protein
  • MDM4-related protein 1
  • MDMXMGC132766
  • mouse double minute 4, human homolog of; p53-binding protein
  • MRP1
  • p53-binding protein Mdm4
  • protein Mdm4
  • Protein Mdmx

Background

MDM4 - Mdm4, transformed 3T3 cell double minute 4, p53 binding protein (mouse)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NBP2-66958
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82820
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46467
Species: Hu
Applications: WB, IHC
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF6278
Species: Hu, Mu
Applications: WB
NBP2-67286
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
NBP2-67117
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00004194-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for MDMX Partial Recombinant Protein (H00004194-Q01) (0)

There are no publications for MDMX Partial Recombinant Protein (H00004194-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MDMX Partial Recombinant Protein (H00004194-Q01) (0)

There are no reviews for MDMX Partial Recombinant Protein (H00004194-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MDMX Partial Recombinant Protein (H00004194-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MDMX Products

Bioinformatics Tool for MDMX Partial Recombinant Protein (H00004194-Q01)

Discover related pathways, diseases and genes to MDMX Partial Recombinant Protein (H00004194-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MDMX Partial Recombinant Protein (H00004194-Q01)

Discover more about diseases related to MDMX Partial Recombinant Protein (H00004194-Q01).
 

Pathways for MDMX Partial Recombinant Protein (H00004194-Q01)

View related products by pathway.

PTMs for MDMX Partial Recombinant Protein (H00004194-Q01)

Learn more about PTMs related to MDMX Partial Recombinant Protein (H00004194-Q01).
 

Research Areas for MDMX Partial Recombinant Protein (H00004194-Q01)

Find related products by research area.

Blogs on MDMX

There are no specific blogs for MDMX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MDMX Antibody
NB100-556

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MDMX Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MDM4