MDMX Antibody

Images

 
Immunohistochemistry-Paraffin: MDMX Antibody [NBP1-87733] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MDMX Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SFSVKDPSPLYDMLRKNLVTLATATTDAAQTLALAQDHSMDIPSQDQLKQSAEESSTSRKRTTEDDIPTLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MDM4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MDMX Protein (NBP1-87733PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MDMX Antibody

  • DKFZp781B1423
  • double minute 4 homolog
  • Double minute 4 protein
  • double minute 4, human homolog of; p53-binding protein
  • HDMX
  • Mdm2-like p53-binding protein
  • Mdm4 p53 binding protein homolog (mouse)
  • Mdm4, transformed 3T3 cell double minute 4, p53 binding protein (mouse)
  • Mdm4, transformed 3T3 cell double minute 4, p53 binding protein
  • MDM4-related protein 1
  • MDMXMGC132766
  • mouse double minute 4, human homolog of; p53-binding protein
  • MRP1
  • p53-binding protein Mdm4
  • protein Mdm4
  • Protein Mdmx

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-94881
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF6278
Species: Hu, Mu
Applications: WB
NBP2-52506
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87733
Species: Hu
Applications: IHC, IHC-P

Publications for MDMX Antibody (NBP1-87733) (0)

There are no publications for MDMX Antibody (NBP1-87733).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MDMX Antibody (NBP1-87733) (0)

There are no reviews for MDMX Antibody (NBP1-87733). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MDMX Antibody (NBP1-87733) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MDMX Products

Bioinformatics Tool for MDMX Antibody (NBP1-87733)

Discover related pathways, diseases and genes to MDMX Antibody (NBP1-87733). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MDMX Antibody (NBP1-87733)

Discover more about diseases related to MDMX Antibody (NBP1-87733).
 

Pathways for MDMX Antibody (NBP1-87733)

View related products by pathway.

PTMs for MDMX Antibody (NBP1-87733)

Learn more about PTMs related to MDMX Antibody (NBP1-87733).
 

Research Areas for MDMX Antibody (NBP1-87733)

Find related products by research area.

Blogs on MDMX

There are no specific blogs for MDMX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MDMX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MDM4