MVP Antibody (2H3-1A6)

Images

 
Western Blot: MVP Antibody (2H3-1A6) [H00009961-M01] - MVP monoclonal antibody (M01), clone 2H3-1A6 Analysis of MVP expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: MVP Antibody (2H3-1A6) [H00009961-M01] - Analysis of monoclonal antibody to MVP on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: MVP Antibody (2H3-1A6) [H00009961-M01] - Analysis of monoclonal antibody to MVP on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma. Antibody concentration 3 ug/ml.
Sandwich ELISA: MVP Antibody (2H3-1A6) [H00009961-M01] - Detection limit for recombinant GST tagged MVP is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
2H3-1A6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MVP Antibody (2H3-1A6) Summary

Immunogen
MVP (AAH15623, 1 a.a. ~ 894 a.a) full length recombinant protein with GST tag.MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNER VLFAPMRMVTVPPRHYCTVANPVSRDAQGLVLFDVTGQVRLR HADLEIRLAQDPFPLYPGEVLEKDITPLQVVLPNTALHLKAL LDFEDKDGDKVVAGDEWLFEGPGTYIPRKEVEVVEIIQATII RQNQALRLRARKECWDRDGKERVTGEEWLVTTVGAYLPAVFE EVLDLVDAVILTEKTALHLRARRNFRDFRGVSRRT
Localization
Cytoplasmic, 5% are nucleus associated and localize to the nuclear pore complexes
Specificity
MVP - major vault protein
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MVP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publications using
H00009961-M01 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MVP Antibody (2H3-1A6)

  • LRPVAULT1
  • Lung resistance-related protein
  • major vault protein

Background

This gene encodes the major vault protein which is a lung resistance-related protein. Vaults are multi-subunit structures that may be involved in nucleo-cytoplasmic transport. This protein mediates drug resistance, perhaps via a transport process. It is widely distributed in normal tissues, and overexpressed in multidrug-resistant cancer cells. The protein overexpression is a potentially useful marker of clinical drug resistance. This gene produces two transcripts by using two alternative exon 2 sequences; however, the open reading frames are the same in both transcripts.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-46466
Species: Hu
Applications: IHC
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NB100-556
Species: Hu
Applications: WB, IP
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6278
Species: Hu, Mu
Applications: WB
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00009961-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for MVP Antibody (H00009961-M01)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for MVP Antibody (H00009961-M01) (0)

There are no reviews for MVP Antibody (H00009961-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MVP Antibody (H00009961-M01). (Showing 1 - 1 of 1 FAQs).

  1. Are there any MVP antibodies that will recognize mouse and can be used for immunofluorescence?
    • At this time we do not have an MVP antibody that will recognize mouse and has been used for immunofluorescence. If you would like to try an antibody in an untested species or application you would qualify for our Innovator's Reward program. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.

Secondary Antibodies

 

Isotype Controls

Additional MVP Products

Bioinformatics Tool for MVP Antibody (H00009961-M01)

Discover related pathways, diseases and genes to MVP Antibody (H00009961-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MVP Antibody (H00009961-M01)

Discover more about diseases related to MVP Antibody (H00009961-M01).
 

Pathways for MVP Antibody (H00009961-M01)

View related products by pathway.

PTMs for MVP Antibody (H00009961-M01)

Learn more about PTMs related to MVP Antibody (H00009961-M01).
 

Research Areas for MVP Antibody (H00009961-M01)

Find related products by research area.

Blogs on MVP

There are no specific blogs for MVP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MVP Antibody (2H3-1A6) and receive a gift card or discount.

Bioinformatics

Gene Symbol MVP
Entrez
OMIM
Uniprot