MDM1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MDM1 Antibody [NBP1-85839] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & centrosome.

Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.

Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Staining of human liver shows negative to very weak cytoplasmic positivity in hepatocytes.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MDM1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MDM1 Antibody - BSA Free (NBP1-85839) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IPKYPTNPPGQLPSPPHVPSYWHPSRRIQGSLRDPEFQHNVGKARMNNLQLPQHEAFNDEDEDRLSEISARSAASSLRAFQTLARAKKRKEN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MDM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MDM1 Protein (NBP1-85839PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MDM1 Antibody - BSA Free

• FLJ95264
• Mdm1 nuclear protein homolog (mouse)
• Mdm4, transformed 3T3 cell double minute 1, p53 binding protein (mouse)
• Mdm4, transformed 3T3 cell double minute 1, p53 binding protein
• nuclear protein double minute 1
• nuclear protein MDM1

Background

MDM1 encodes a nuclear protein similar to the mouse double minute 1 protein. The mouse gene is located in double minute (DM) chromatin particles and is amplified in the mouse transformed 3T3 cell line, and the protein is able to bind to p53. In mouse several transcripts have been described for this gene which result from alternative polyadenylation, splicing and exon usage. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for MDM1 Antibody (NBP1-85839) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Anatoli Grechov WB Human 07/02/2014

Summary

• Application: Western Blot
• Sample Tested: 293T lysates
• Species: Human

FAQs for MDM1 Antibody (NBP1-85839). (Showing 1 - 1 of 1 FAQ).

1. I used an Ab NBP-1 85839 from your company in NSLC cells for western and am wondering what the expected size of this protein should be.
   • The MDM1 protein has an expected molecular weight of 80kDa. There are four isoforms to this protein and our product NBP1-85839 is capable of detecting isoforms 1 and 4 (80 and 76kDa respectively). uniprot site In western blot, our lab has detected bands from 70-78kDa. Since there is a phophoserine residue at amino acid 83, it is possible to detect bands up to 80-85kDa.

Bioinformatics

• Gene Symbol: MDM1