MDM1 Antibody

Images

 
Western Blot: MDM1 Antibody [NBP1-85839] - Analysis in 293T cells. Image from verified customer review.
Immunocytochemistry/ Immunofluorescence: MDM1 Antibody [NBP1-85839] - Staining of human cell line A-431 shows positivity in cytoplasm and centrosome.
Immunohistochemistry-Paraffin: MDM1 Antibody [NBP1-85839] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Western Blot: MDM1 Antibody [NBP1-85839] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

MDM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IPKYPTNPPGQLPSPPHVPSYWHPSRRIQGSLRDPEFQHNVGKARMNNLQLPQHEAFNDEDEDRLSEISARSAASSLRAFQTLARAKKRKEN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MDM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
MDM1 Protein (NBP1-85839PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-85839 in the following applications:

Alternate Names for MDM1 Antibody

  • FLJ95264
  • Mdm1 nuclear protein homolog (mouse)
  • Mdm4, transformed 3T3 cell double minute 1, p53 binding protein (mouse)
  • Mdm4, transformed 3T3 cell double minute 1, p53 binding protein
  • nuclear protein double minute 1
  • nuclear protein MDM1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
NBP2-34061
Species: Hu
Applications: IHC, IHC-P
NBP1-31370
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-52030
Species: Hu
Applications: WB, PEP-ELISA
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP2-31983
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00023327-M04
Species: Hu
Applications: WB, ELISA, IP
NB100-64387
Species: Mu
Applications: B/N, ELISA, Func, IHC, IHC-Fr
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1591
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56736
Species: Hu, Mu, Rt
Applications: WB
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86286
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85839
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MDM1 Antibody (NBP1-85839) (0)

There are no publications for MDM1 Antibody (NBP1-85839).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MDM1 Antibody (NBP1-85839) (1) 41

Average Rating: 4
(Based on 1 reviews)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-85839:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot MDM1 NBP1-85839
Enlarge
reviewed by:
Anatoli Grechov
WB Human 07/02/2014
View

Summary

ApplicationWestern Blot
Sample Tested293T lysates
SpeciesHuman

Blocking

Blocking Details5% BSA in PBS

Primary Anitbody

Dilution Ratio1:1000 diluted in PBS with triton X-100, blot was incubated at room temperature on a rocker

Secondary Antibody

Secondary Descriptionanti-rabbit IgG HRP conjugate (Jackson Labs)
Secondary Manufacturer Cat#111-005-045
Secondary Concentration1:20000

Details

Detection NotesProbed using Visualizer Western Blot Detection Kit (Millipore) and captured on X-ray films, 30 sec exposure

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MDM1 Antibody (NBP1-85839). (Showing 1 - 1 of 1 FAQ).

  1. I used an Ab NBP-1 85839 from your company in NSLC cells for western and am wondering what the expected size of this protein should be.
    • The MDM1 protein has an expected molecular weight of 80kDa. There are four isoforms to this protein and our product NBP1-85839 is capable of detecting isoforms 1 and 4 (80 and 76kDa respectively). uniprot site In western blot, our lab has detected bands from 70-78kDa. Since there is a phophoserine residue at amino acid 83, it is possible to detect bands up to 80-85kDa.

Secondary Antibodies

 

Isotype Controls

Additional MDM1 Antibody Products

Related Products by Gene

Bioinformatics Tool for MDM1 Antibody (NBP1-85839)

Discover related pathways, diseases and genes to MDM1 Antibody (NBP1-85839). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MDM1 Antibody (NBP1-85839)

Discover more about diseases related to MDM1 Antibody (NBP1-85839).
 

Pathways for MDM1 Antibody (NBP1-85839)

View related products by pathway.

PTMs for MDM1 Antibody (NBP1-85839)

Learn more about PTMs related to MDM1 Antibody (NBP1-85839).

Blogs on MDM1

There are no specific blogs for MDM1, but you can read our latest blog posts.

Contact Information

Product PDFs

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anatoli Grechov
07/02/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol MDM1

Customers Who Bought This Also Bought