MDM1 Antibody

Images

 
Western Blot: MDM1 Antibody [NBP1-85839] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: MDM1 Antibody [NBP1-85839] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & centrosome.
Immunohistochemistry-Paraffin: MDM1 Antibody [NBP1-85839] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Western Blot: MDM1 Antibody [NBP1-85839] - Analysis in 293T cells. Image from verified customer review.
Immunohistochemistry-Paraffin: MDM1 Antibody [NBP1-85839] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MDM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IPKYPTNPPGQLPSPPHVPSYWHPSRRIQGSLRDPEFQHNVGKARMNNLQLPQHEAFNDEDEDRLSEISARSAASSLRAFQTLARAKKRKEN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MDM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
MDM1 Protein (NBP1-85839PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-85839 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MDM1 Antibody

  • FLJ95264
  • Mdm1 nuclear protein homolog (mouse)
  • Mdm4, transformed 3T3 cell double minute 1, p53 binding protein (mouse)
  • Mdm4, transformed 3T3 cell double minute 1, p53 binding protein
  • nuclear protein double minute 1
  • nuclear protein MDM1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
NBP2-34061
Species: Hu
Applications: IHC, IHC-P
NBP1-31370
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-52030
Species: Hu
Applications: WB, PEP-ELISA
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP2-31983
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-54974
Species: Hu
Applications: WB
NB100-64387
Species: Mu
Applications: B/N, ELISA, Func, IHC, IHC-Fr
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1591
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56736
Species: Hu, Mu, Rt
Applications: WB
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86286
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MDM1 Antibody (NBP1-85839) (0)

There are no publications for MDM1 Antibody (NBP1-85839).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for MDM1 Antibody (NBP1-85839) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-85839:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot MDM1 NBP1-85839
Enlarge
reviewed by:
Anatoli Grechov
WB Human 07/02/2014
View

Summary

ApplicationWestern Blot
Sample Tested293T lysates
SpeciesHuman

Blocking

Blocking Details5% BSA in PBS

Primary Anitbody

Dilution Ratio1:1000 diluted in PBS with triton X-100, blot was incubated at room temperature on a rocker

Secondary Antibody

Secondary Descriptionanti-rabbit IgG HRP conjugate (Jackson Labs)
Secondary Manufacturer Cat#111-005-045
Secondary Concentration1:20000

Details

Detection NotesProbed using Visualizer Western Blot Detection Kit (Millipore) and captured on X-ray films, 30 sec exposure

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MDM1 Antibody (NBP1-85839). (Showing 1 - 1 of 1 FAQ).

  1. I used an Ab NBP-1 85839 from your company in NSLC cells for western and am wondering what the expected size of this protein should be.
    • The MDM1 protein has an expected molecular weight of 80kDa. There are four isoforms to this protein and our product NBP1-85839 is capable of detecting isoforms 1 and 4 (80 and 76kDa respectively). uniprot site In western blot, our lab has detected bands from 70-78kDa. Since there is a phophoserine residue at amino acid 83, it is possible to detect bands up to 80-85kDa.

Secondary Antibodies

 

Isotype Controls

Additional MDM1 Antibody Products

Related Products by Gene

Bioinformatics Tool for MDM1 Antibody (NBP1-85839)

Discover related pathways, diseases and genes to MDM1 Antibody (NBP1-85839). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MDM1 Antibody (NBP1-85839)

Discover more about diseases related to MDM1 Antibody (NBP1-85839).
 

Pathways for MDM1 Antibody (NBP1-85839)

View related products by pathway.

PTMs for MDM1 Antibody (NBP1-85839)

Learn more about PTMs related to MDM1 Antibody (NBP1-85839).

Blogs on MDM1

There are no specific blogs for MDM1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anatoli Grechov
07/02/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol MDM1

Customers Who Bought This Also Bought