IFN-alpha 13 Antibody (3F9)

Images

 
Western Blot: IFN-alpha 13 Antibody (3F9) [H00003447-M03] - Analysis of IFNA13 expression in transfected 293T cell line by IFNA13 monoclonal antibody (M03), clone 3F9. Lane 1: IFNA13 transfected lysatE (21.7 KDa). Lane ...read more
Sandwich ELISA: IFN-alpha 13 Antibody (3F9) [H00003447-M03] - Detection limit for recombinant GST tagged IFNA13 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3F9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IFN-alpha 13 Antibody (3F9) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
IFNA13 (NP_008831, 91 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE
Specificity
Reacts with interferon, alpha 13.
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IFNA13
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IFN-alpha 13 Antibody (3F9)

  • IFL
  • IFNA1
  • IFNA13
  • IFNalpha 13
  • IFN-alpha 13
  • IFN-alpha 1b
  • IFN-alpha-1/13
  • interferon alpha-1/13
  • Interferon alpha-D
  • interferon, alpha 13
  • LeIF D

Background

Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

11200-2
Species: Hu
8499-IF
Species: Hu
Applications: BA
NBP3-06987
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KO, WB
H00003451-D01P
Species: Hu, Rt
Applications: ICC/IF, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
AF4715
Species: Mu
Applications: WB
AF4019
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
NBP3-15896
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32905
Species: Bv, Hu, Pm, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP1-59069
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00004507-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF5366
Species: Hu, Mu, Rt
Applications: Simple Western, WB
MAB15041
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
11145-1
Species: Hu
Applications: BA
NB100-56507
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
H00003447-M03
Species: Hu
Applications: WB, ELISA

Publications for IFN-alpha 13 Antibody (H00003447-M03) (0)

There are no publications for IFN-alpha 13 Antibody (H00003447-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFN-alpha 13 Antibody (H00003447-M03) (0)

There are no reviews for IFN-alpha 13 Antibody (H00003447-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFN-alpha 13 Antibody (H00003447-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFN-alpha 13 Antibody (3F9) and receive a gift card or discount.

Bioinformatics

Gene Symbol IFNA13
Entrez
Uniprot