MDH2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MDH2 Antibody [NBP1-86036] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.

Staining of human fallopian tube shows strong positivity in cytoplasm granular in cells in tubules.

Staining of human duodenum shows strong positivity in cytoplasm granular in glandular cells.

Staining of human duodenum, fallopian tube, kidney and liver using Anti-MDH2 antibody NBP1-86036 (A) shows similar protein distribution across tissues to independent antibody NBP1-89540 (B).

Staining of human liver shows strong positivity in cytoplasm granular in hepatocytes.

Staining of human kidney shows strong positivity in cytoplasm granular in cells in tubules.

Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-MDH2 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MDH2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MDH2 Antibody - BSA Free (NBP1-86036) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-MDH2 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGSATLSM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MDH2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 25763823). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MDH2 Protein (NBP1-86036PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23334578)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MDH2 Antibody - BSA Free

• EC 1.1.1
• EC 1.1.1.37
• malate dehydrogenase 2, NAD (mitochondrial)
• MDH
• MDH2
• MGC:3559
• mitochondrial
• MOR1

Background

Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MDH2 Antibody (NBP1-86036)(2)

Publications using NBP1-86036

• Rzem R, Achouri Y, Marbaix E et al. A Mouse Model of L-2-Hydroxyglutaric Aciduria, a Disorder of Metabolite Repair. PLoS One 2015-01-01 [PMID: 25763823] (WB, Mouse)
• Shin JB, Krey JF, Hassan A et al. Molecular Architecture of the Chick Vestibular Hair Bundle. Nat Neurosci 2013-03-01 [PMID: 23334578]

Bioinformatics

• Gene Symbol: MDH2