MDH2 Antibody

Images

 
Genetic Strategies: Western Blot: MDH2 Antibody [NBP1-86036] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1,. Remaining relative intensity is presented. Loading control: ...read more
Immunocytochemistry/ Immunofluorescence: MDH2 Antibody [NBP1-86036] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MDH2 Antibody [NBP1-86036] - Staining of human colon.
Western Blot: MDH2 Antibody [NBP1-86036] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: MDH2 Antibody [NBP1-86036] - Staining of human lymph node.
Immunohistochemistry-Paraffin: MDH2 Antibody [NBP1-86036] - Staining of human liver.
Immunohistochemistry-Paraffin: MDH2 Antibody [NBP1-86036] - Staining of human kidney.
Independent Antibodies: Immunohistochemistry-Paraffin: MDH2 Antibody [NBP1-86036] - Staining of human colon, kidney, liver and lymph node using Anti-MDH2 antibody NBP1-86036 (A) shows similar protein distribution ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MDH2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGSATLSM
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MDH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 25763823). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MDH2 Protein (NBP1-86036PEP)
Publications
Read Publications using
NBP1-86036 in the following applications:

  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23334578)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MDH2 Antibody

  • EC 1.1.1
  • EC 1.1.1.37
  • malate dehydrogenase 2, NAD (mitochondrial)
  • MDH
  • MGC:3559
  • mitochondrial
  • MOR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-85871
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89559
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87069
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP2-74045
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-01506
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-236
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
NBP2-02615
Species: Hu, Pm, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-89515
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45880
Species: Hu, Mu, Rt
Applications: IF, IHC, IHC-P, WB
NBP1-31225
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47804
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
AF009
Species: Hu
Applications: IHC, WB
NBP2-22166
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-03621
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-16679
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for MDH2 Antibody (NBP1-86036)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for MDH2 Antibody (NBP1-86036) (0)

There are no reviews for MDH2 Antibody (NBP1-86036). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MDH2 Antibody (NBP1-86036) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MDH2 Products

Bioinformatics Tool for MDH2 Antibody (NBP1-86036)

Discover related pathways, diseases and genes to MDH2 Antibody (NBP1-86036). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MDH2 Antibody (NBP1-86036)

Discover more about diseases related to MDH2 Antibody (NBP1-86036).
 

Pathways for MDH2 Antibody (NBP1-86036)

View related products by pathway.

PTMs for MDH2 Antibody (NBP1-86036)

Learn more about PTMs related to MDH2 Antibody (NBP1-86036).

Blogs on MDH2.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MDH2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MDH2