Recombinant Human MDA5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MDA5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 928-1023 of Human IFIH1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:HVNMTPEFKELYIVRENKALQKKCADYQINGEIICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSECCLFSD

Protein/Peptide Type
Partial Recombinant Protein
Gene
IFIH1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MDA5 Protein

  • CADM-140 autoantigen
  • Clinically amyopathic dermatomyositis autoantigen 140 kDa
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide
  • EC 3.6.4.13
  • helicard
  • Helicase with 2 CARD domains
  • Hlcd
  • IDDM19
  • interferon induced with helicase C domain 1
  • interferon-induced helicase C domain-containing protein 1
  • Interferon-induced with helicase C domain protein 1
  • MDA-5MGC133047
  • MDA5RNA helicase-DEAD box protein 116
  • melanoma differentiation associated protein-5
  • Melanoma differentiation-associated protein 5
  • Murabutide down-regulated protein
  • RH116

Background

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein that is upregulated in response to treatment with beta-interferon (IFNB) and a protein kinase C-activating compound, mezerein (MEZ). Irreversible reprogramming of melanomas can be achieved by treatment with both these agents; treatment with either agent alone only achieves reversible differentiation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85348
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
NBP2-24906
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, IF
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF8519
Species: Hu, Mu, Rt
Applications: WB
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF6139
Species: Hu
Applications: ICC
H00064135-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for MDA5 Partial Recombinant Protein (H00064135-Q01) (0)

There are no publications for MDA5 Partial Recombinant Protein (H00064135-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MDA5 Partial Recombinant Protein (H00064135-Q01) (0)

There are no reviews for MDA5 Partial Recombinant Protein (H00064135-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MDA5 Partial Recombinant Protein (H00064135-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MDA5 Products

Bioinformatics Tool for MDA5 Partial Recombinant Protein (H00064135-Q01)

Discover related pathways, diseases and genes to MDA5 Partial Recombinant Protein (H00064135-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MDA5 Partial Recombinant Protein (H00064135-Q01)

Discover more about diseases related to MDA5 Partial Recombinant Protein (H00064135-Q01).
 

Pathways for MDA5 Partial Recombinant Protein (H00064135-Q01)

View related products by pathway.

PTMs for MDA5 Partial Recombinant Protein (H00064135-Q01)

Learn more about PTMs related to MDA5 Partial Recombinant Protein (H00064135-Q01).
 

Research Areas for MDA5 Partial Recombinant Protein (H00064135-Q01)

Find related products by research area.

Blogs on MDA5.

MDA5 - Part of the RIG-I-like Receptor Family
The innate immune system is responsible for reacting to viral infections through recognition of various viral components. Like toll-like receptor 3 (TLR3), MDA5 recognizes double-stranded (ds) RNA which is a molecular pattern indicative of viral infec...  Read full blog post.

Customers Who Bought This Also Bought

MDA5 Antibody
NB110-1244

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MDA5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IFIH1