| Reactivity | HuSpecies Glossary |
| Applications | ELISA, IHC |
| Clone | 3F6 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse MDA5 Antibody (3F6) - Azide and BSA Free (H00064135-M02) is a monoclonal antibody validated for use in IHC and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | IFIH1 (NP_071451.2, 928 a.a. ~ 1023 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HVNMTPEFKELYIVRENKALQKKCADYQINGEIICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSECCLFSD |
| Specificity | IFIH1 - interferon induced with helicase C domain 1 (3F6) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | IFIH1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This product is useful for ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for MDA5 Antibody (H00064135-M02)Find related products by research area.
|
|
Read full blog post. |
|
MDA5 - Part of the RIG-I-like Receptor Family The innate immune system is responsible for reacting to viral infections through recognition of various viral components. Like toll-like receptor 3 (TLR3), MDA5 recognizes double-stranded (ds) RNA which is a molecular pattern indicative of viral infec... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.