MCMBP Antibody

Images

 
Western Blot: MCMBP Antibody [NBP1-90746] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: MCMBP Antibody [NBP1-90746] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.
Immunohistochemistry-Paraffin: MCMBP Antibody [NBP1-90746] - staining of human tonsil shows moderate nuclear positivity in a subset of cells
Western Blot: MCMBP Antibody [NBP1-90746] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MCMBP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SPRNTTLERQTFYCVPVPGESTWVKEAYVNANQARVSPSTSYTPSRHKRSYEDDDDMDLQPNKQKDQHAGARQAGSVGGLQWCGEPKRLETEASTGQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MCMBP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MCMBP Protein (NBP1-90746PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MCMBP Antibody

  • C10orf119
  • FLJ13081
  • MCM-binding protein
  • MCM-BP
  • minichromosome maintenance complex binding protein
  • mini-chromosome maintenance complex-binding protein
  • minichromosome maintenance complex-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB92171
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-46403
Species: Hu
Applications: IHC
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-288
Species: Hu, Xp
Applications: WB, IHC, IHC-P, IP, PLA
NB100-290
Species: Hu, Mu, Xp
Applications: IP (-), WB, IHC, PLA
NBP1-82642
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5540
Species: Mu
Applications: WB
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NB100-249
Species: Hu
Applications: WB, IHC, PLA, ICC
H00010926-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-03346
Species: Hu
Applications: WB, IHC-P, IP, PLA
NB200-581
Species: Hu, Rt
Applications: WB, IP
NBP2-32016
Species: Hu
Applications: IHC, IHC-P
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00084172-M10
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-79778
Species: Hu, Xp
Applications: WB, IHC, PLA
H00005457-M04
Species: Hu
Applications: WB, ELISA
NBP1-90746
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MCMBP Antibody (NBP1-90746) (0)

There are no publications for MCMBP Antibody (NBP1-90746).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCMBP Antibody (NBP1-90746) (0)

There are no reviews for MCMBP Antibody (NBP1-90746). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MCMBP Antibody (NBP1-90746) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MCMBP Products

MCMBP NBP1-90746

Bioinformatics Tool for MCMBP Antibody (NBP1-90746)

Discover related pathways, diseases and genes to MCMBP Antibody (NBP1-90746). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCMBP Antibody (NBP1-90746)

Discover more about diseases related to MCMBP Antibody (NBP1-90746).
 

Pathways for MCMBP Antibody (NBP1-90746)

View related products by pathway.

PTMs for MCMBP Antibody (NBP1-90746)

Learn more about PTMs related to MCMBP Antibody (NBP1-90746).

Blogs on MCMBP

There are no specific blogs for MCMBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MCMBP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MCMBP