![Western Blot: MCMBP Antibody [NBP1-90746] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/MCMBP-Antibody-Western-Blot-NBP1-90746-img0007.jpg "Western Blot: MCMBP Antibody [NBP1-90746] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit MCMBP Antibody - BSA Free (NBP1-90746) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-MCMBP Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SPRNTTLERQTFYCVPVPGESTWVKEAYVNANQARVSPSTSYTPSRHKRSYEDDDDMDLQPNKQKDQHAGARQAGSVGGLQWCGEPKRLETEASTGQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MCMBP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-90746 | Applications | Species |
|---|---|---|
| Ochs, F, Karemore, G Et al. Stabilization of chromatin topology safeguards genome integrity. Nature 2019-10-01 [PMID: 31645724] (ICC/IF, Drosophila melanogaster) | ICC/IF | Drosophila melanogaster |
Secondary Antibodies |
Isotype Controls |
Research Areas for MCMBP Antibody (NBP1-90746)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MCMBP |
![Immunocytochemistry/Immunofluorescence: MCMBP Antibody [NBP1-90746] - Staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/MCMBP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90746-img0009.jpg "Immunocytochemistry/Immunofluorescence: MCMBP Antibody [NBP1-90746] - Staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: MCMBP Antibody [NBP1-90746] - Staining of human tonsil shows moderate nuclear positivity in germinal center cells.](http://images.novusbio.com/fullsize/MCMBP-Antibody-Immunohistochemistry-Paraffin-NBP1-90746-img0013.jpg "Immunohistochemistry-Paraffin: MCMBP Antibody [NBP1-90746] - Staining of human tonsil shows moderate nuclear positivity in germinal center cells.")
![Western Blot: MCMBP Antibody [NBP1-90746] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize/MCMBP-Antibody-Western-Blot-NBP1-90746-img0005.jpg "Western Blot: MCMBP Antibody [NBP1-90746] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue")
![Immunohistochemistry-Paraffin: MCMBP Antibody [NBP1-90746] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/MCMBP-Antibody-Immunohistochemistry-Paraffin-NBP1-90746-img0010.jpg "Immunohistochemistry-Paraffin: MCMBP Antibody [NBP1-90746] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: MCMBP Antibody [NBP1-90746] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/MCMBP-Antibody-Immunohistochemistry-Paraffin-NBP1-90746-img0011.jpg "Immunohistochemistry-Paraffin: MCMBP Antibody [NBP1-90746] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: MCMBP Antibody [NBP1-90746] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/MCMBP-Antibody-Immunohistochemistry-Paraffin-NBP1-90746-img0012.jpg "Immunohistochemistry-Paraffin: MCMBP Antibody [NBP1-90746] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.")
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Neutralization G-CSF Antibody (67604) [Unconjugated]](https://images.novusbio.com/images2/G-CSF_MAB414_Block_Neutralize_9188.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")