Home » MCM3AP » MCM3AP Antibodies » MCM3AP Antibody

MCM3AP Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: MCM3AP Antibody [NBP1-83393] - Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear membrane & cytosol.
Immunocytochemistry/ Immunofluorescence: MCM3AP Antibody [NBP1-83393] - Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear membrane & cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

MCM3AP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HEPAEDSDPLSRGDHPPDKRPVRLNRPRGGTLFGRTIQDVFKSNKEVGRLGNKEAKKETGFVESAESDHMAIPGGNQSVLAPSRIPGVNKEEETESREKKEDSLRGTPARQSNRSESTDSLGGLSPSEVTAIQCKNIPDYL
Specificity
Specificity of human MCM3AP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MCM3AP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MCM3AP Protein (NBP1-83393PEP)
Publications
Read Publication using NBP1-83393.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%). Reactivity reported in scientific literature (PMID: 23652018)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MCM3AP Antibody

  • 80 kDa MCM3-associated protein
  • FLJ44336
  • GANPFLJ45306
  • human mRNA for MCM3 import factor10Protein GANP
  • KIAA0572MAP80germinal center-associated nuclear protein
  • Map80
  • MCM3 import protein
  • MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) associated protein
  • MCM3 minichromosome maintenance deficient 3 associated protein
  • minichromosome maintenance complex component 3 associated protein
  • minichromosome maintenance deficient (S. cerevisiae) 3-associated protein
  • minichromosome maintenance deficient 3-associated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MCM3 Antibody
(JB99-35)
NBP2-75569
Western Blot: MCM3 Antibody (JB99-35) [NBP2-75569] - Analysis of MCM3 on mouse thymus tissue (1), NIH-3T3 cell (2) and Hela (3)cell lysates using anti-MCM3 antibody at 1/500 dilution.
Immunocytochemistry/Immunofluorescence: MCM3 Antibody (JB99-35) [NBP2-75569] - Staining MCM3 in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: MCM3 Antibody (JB99-35) [NBP2-75569] - Analysis of paraffin-embedded rat testis tissue using anti-MCM3 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AICDA Antibody
(359218)
MAB39102
AICDA was detected in immersion fixed Ramos human Burkitt's lymphoma cell line using Rat Anti-Human AICDA Monoclonal Antibody (Catalog # MAB39102) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). Specific staining was localized to surface and cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(1 Publication)
Species: Hu
Applications: ICC
FIG4 Antibody
NBP2-56977
Western Blot: FIG4 Antibody [NBP2-56977] - Analysis in human cell line U-87 MG.
Immunocytochemistry/Immunofluorescence: FIG4 Antibody [NBP2-56977] - Staining of human cell line SK-MEL-30 shows localization to vesicles & lipid droplets. Antibody staining is shown in green.
Species: Hu
Applications: WB, ICC/IF
PIKFyve/PIP5K3
Antibody (6C7)
H00200576-M01
Western Blot: PIKFyve/PIP5K3 Antibody (6C7) [H00200576-M01] - Analysis of PIP5K3 expression in transfected 293T cell line by PIP5K3 monoclonal antibody (M01), clone 6C7.Lane 1: PIP5K3 transfected lysate(50.2 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: PIKFyve/PIP5K3 Antibody (6C7) [H00200576-M01] - Analysis of monoclonal antibody to PIP5K3 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: PIKFyve/PIP5K3 Antibody (6C7) [H00200576-M01] - Analysis of monoclonal antibody to PIP5K3 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi, S-ELISA
VAC14 Antibody
H00055697-B01P
Western Blot: VAC14 Antibody [H00055697-B01P] - Analysis of VAC14 expression in human liver.
Immunocytochemistry/Immunofluorescence: VAC14 Antibody [H00055697-B01P] - Analysis of purified antibody to VAC14 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: VAC14 Antibody [H00055697-B01P] - Analysis of VAC14 expression in transfected 293T cell line by VAC14 polyclonal antibody. Lane 1: VAC14 transfected lysate(86.02 KDa). Lane 2: Non-transfected lysate.
Species: Hu
Applications: WB, ICC/IF
Niemann-Pick C1
Antibody
NB400-148
Knockout Validated: Niemann-Pick C1 Antibody [NB400-148] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and NPC1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Rabbit Anti-Human NPC1 Polyclonal Antibody (Catalog # NB400-148) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for NPC1 at approximately 240-260 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunohistochemistry-Paraffin: Niemann-Pick C1 Antibody [NB400-148] - Staining of human brain, cortex, neurons and astrocytes.
Western Blot: Niemann-Pick C1 Antibody [NB400-148] - NPC proteins in mouse lungs. Western blot of wild type (W) littermates, NPC1 (Mut) or NPC2 (Mut) mutant mouse lungs using anti-NPC1 or -NPC2 antibody. beta-actin used as a loading control. 30 ug protein/lane. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0067084), licensed under a CC-BY licence.
(5 Reviews)
(41 Publications)
Species: Hu, Mu, Rt, Po, ChHa, Ha, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P, IP, KD, KO
NXF1 Antibody
NBP1-31649
Western Blot: NXF1 Antibody [NBP1-31649] - Sample (30 ug of whole cell lysate) A: Hela B: Molt-4 7. 5% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: NXF1 Antibody [NBP1-31649] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: NXF1 Antibody [NBP1-31649] - Paraffin-embedded NCIN87 Xenograft, using antibody at 1:100 dilution.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
APOBEC3B Antibody
NBP2-82073
Western Blot: APOBEC3B Antibody [NBP2-82073] - Analysis of APOBEC3B in HepG2 cell lysate with APOBEC3B antibody at 1 ug/ml.
Immunocytochemistry/Immunofluorescence: APOBEC3B Antibody [NBP2-82073] - Immunofluorescence of APOBEC3B in human small intestine tissue with APOBEC3B antibody at 20 ug/mL.
Immunohistochemistry: APOBEC3B Antibody [NBP2-82073] - Immunohistochemistry of APOBEC3B in human small intestine tissue with APOBEC3B antibody at 5 ug/mL.
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Citidine Deaminase
Antibody
NBP2-39019
Western Blot: Citidine Deaminase Antibody [NBP2-39019] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue
Immunocytochemistry/Immunofluorescence: Citidine Deaminase Antibody [NBP2-39019] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Citidine Deaminase Antibody [NBP2-39019] - Staining of human cerebral cortex shows low expression as expected.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(32 Reviews)
(647 Publications)
Species: Hu
RAE1 Antibody
NB100-1894
Western Blot: RAE1 Antibody [NB100-1894] - Staining of HepG2 (A), HeLa (B), Jurkat (C) and MCF7 (D) lysates (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: RAE1 Antibody [NB100-1894] - Staining of paraffin embedded Human Heart. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: RAE1 Antibody [NB100-1894] - Staining of paraffin embedded Human Cortex. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
GLI-2 Antibody
AF3635
GLI‑2 was detected in immersion fixed frozen sections of mouse embryo (15 d.p.c.) using Goat Anti-Mouse GLI‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3635) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling when primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. Specific staining was localized to developing muscle. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(5 Reviews)
(14 Publications)
Species: Mu
Applications: WB, IHC
Galanin Antibody
NBP1-45217
Western Blot: Galanin Antibody [NBP1-45217] - Staining of Mouse (A) and Rat (B) Brain lysate (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence
Western Blot: Galanin Antibody [NBP1-45217] - Analysis of Galanin in Human Cerebellum lysate (35ug protein in RIPA buffer) using NBP1-45217 at 1ug/ml. Primary incubation was 1 hour. Detected by chemiluminescence.
(2 Publications)
Species: Hu, Mu, Rt, Xp
Applications: WB, IHC, IHC-Fr, PEP-ELISA
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - PC12 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-p53 Antibody (PAb 240) NB200-103 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(28 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
CD45 Antibody
(30-F11)
NB100-77417
Flow Cytometry: CD45 Antibody (30-F11) [NB100-77417] - Analysis of CD45 (30F11) in freshly isolated mouse (Balb C) splenocytes (1x10^6) were stained with [NB100-77417] at 1:1000 dilution and detected with FITC conjugated donkey anti-rat IgG secondary (orange). Shown with rat IgG isotype control (blue).
Immunohistochemistry-Paraffin: CD45 Antibody (30-F11) [NB100-77417] - Analysis of FFPE section of mouse spleen using rat monoclonal CD45 antibody (30-F11) [NB100-77417] at 1:50 dilution. The antibody generated an expected membrane staining in the red and white pulp spleenocytes of the tested spleen section.
Immunohistochemistry-Paraffin: CD45 Antibody (30-F11) [NB100-77417] - Staining of a FFPE mouse liver tissue section using 1:100 dilution of CD45 antibody (30-F11) [NB100-77417]. Signal was detected using AF488 conjugated donkey anti-rat secondary antibody at 1:500 dilution. Image submitted via verified customer review.
(4 Reviews)
(25 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready
SACM1L Antibody
NBP2-97655
Immunocytochemistry/Immunofluorescence: SACM1L Antibody [NBP2-97655] - Immunofluorescence staining of SACM1L in U2OS cells. Cells were fixed with 4% PFA, permeabilzed with 0.1% Triton X-100 in PBS, blocked with 10% serum, and incubated with rabbit anti-Human SACM1L polyclonal antibody (dilution ratio 1:200) at 4C overnight. Then cells were stained with the Alexa Fluor(R)594-conjugated Goat Anti-rabbit IgG secondary antibody (red) and counterstained with DAPI (blue).Positive staining was localized to Cytoplasm.
Immunohistochemistry-Paraffin: SACM1L Antibody [NBP2-97655] - Immunochemical staining of human SACM1L in human kidney with rabbit polyclonal antibody at 1:100 dilution, formalin-fixed paraffin embedded sections.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TREX2 Antibody
NBP1-76978
Western Blot: TREX2 Antibody [NBP1-76978] - Rat liver tissue lysate with TREX2 antibody at 2.5 ug/ml.
Immunocytochemistry/Immunofluorescence: TREX2 Antibody [NBP1-76978] - Immunofluorescence of TREX2 in Human Liver cells with TREX2 antibody at 20 ug/mL.
Immunohistochemistry-Paraffin: TREX2 Antibody [NBP1-76978] - Human liver tissue with TREX2 antibody at 2.5 ug/ml.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
PU.1/Spi-1 Antibody
NBP2-27163
Western Blot: PU.1/Spi-1 Antibody [NBP2-27163] - PU.1/Spi1 Antibody [NBP2-27163] - Analysis of PU.1/Spi1 in U937 cell lysate in the 1) absence and 2) presence of immunizing peptide using NBP2-27163.
Flow Cytometry: PU.1/Spi-1 Antibody [NBP2-27163] - PU.1/Spi1 Antibody [NBP2-27163] - Intracellular analysis of PU.1 in mouse RAW cells (top) and PMA treated (20 ng/ml, overnight) human ThP1 cells (bottom) using 1.25 ug/10^6 cells. Green peak represents isotype control this antibody ; red represents anti-PU.1 antibody.
Western Blot: PU.1/Spi1 Antibody [NBP2-27163] - analysis of 293T cell lysate (30ug) using anti-PU.1/Spi1 antibody. Image from verified customer review.
(1 Review)
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
ADCY10 Antibody
NBP1-81765
Immunohistochemistry-Paraffin: ADCY10 Antibody [NBP1-81765] - Staining of human kidney shows strong positivity in tubules.
Species: Hu
Applications: IHC, IHC-P
MCM3AP Antibody
NBP1-83393
MCM3AP Antibody
Species: Hu
Applications: WB, ICC/IF

Publications for MCM3AP Antibody (NBP1-83393)(1)


Reviews for MCM3AP Antibody (NBP1-83393) (0)

There are no reviews for MCM3AP Antibody (NBP1-83393). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MCM3AP Antibody (NBP1-83393) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional MCM3AP Products

Bioinformatics Tool for MCM3AP Antibody (NBP1-83393)

Discover related pathways, diseases and genes to MCM3AP Antibody (NBP1-83393). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCM3AP Antibody (NBP1-83393)

Discover more about diseases related to MCM3AP Antibody (NBP1-83393).
 

Pathways for MCM3AP Antibody (NBP1-83393)

View related products by pathway.

PTMs for MCM3AP Antibody (NBP1-83393)

Learn more about PTMs related to MCM3AP Antibody (NBP1-83393).

Blogs on MCM3AP

There are no specific blogs for MCM3AP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MCM3AP Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol MCM3AP