Home » MCM3AP » MCM3AP Antibodies » MCM3AP Antibody

MCM3AP Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: MCM3AP Antibody [NBP1-83393] - Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear membrane & cytosol.
Immunocytochemistry/ Immunofluorescence: MCM3AP Antibody [NBP1-83393] - Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear membrane & cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

MCM3AP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HEPAEDSDPLSRGDHPPDKRPVRLNRPRGGTLFGRTIQDVFKSNKEVGRLGNKEAKKETGFVESAESDHMAIPGGNQSVLAPSRIPGVNKEEETESREKKEDSLRGTPARQSNRSESTDSLGGLSPSEVTAIQCKNIPDYL
Specificity
Specificity of human MCM3AP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MCM3AP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MCM3AP Protein (NBP1-83393PEP)
Publications
Read Publication using NBP1-83393.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (82%). Reactivity reported in scientific literature (PMID: 23652018)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MCM3AP Antibody

  • 80 kDa MCM3-associated protein
  • FLJ44336
  • GANPFLJ45306
  • human mRNA for MCM3 import factor10Protein GANP
  • KIAA0572MAP80germinal center-associated nuclear protein
  • Map80
  • MCM3 import protein
  • MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) associated protein
  • MCM3 minichromosome maintenance deficient 3 associated protein
  • minichromosome maintenance complex component 3 associated protein
  • minichromosome maintenance deficient (S. cerevisiae) 3-associated protein
  • minichromosome maintenance deficient 3-associated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MCM3 Antibody (4F7)
H00004172-M01
Western Blot: MCM3 Antibody (4F7) [H00004172-M01] - MCM3 monoclonal antibody (M01), clone 4F7. Analysis of MCM3 expression in K-562.
Immunocytochemistry/Immunofluorescence: MCM3 Antibody (4F7) [H00004172-M01] - Analysis of monoclonal antibody to MCM3 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: MCM3 Antibody (4F7) [H00004172-M01] - MCM3 monoclonal antibody (M01), clone 4F7. Analysis of MCM3 expression in HeLa.
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
AICDA Antibody
NBP1-30955
Western Blot: AICDA Antibody [NBP1-30955] - Sample (30 ug of whole cell lysate) A: 293T 12% SDS PAGE, antibody diluted at 1:500.
Immunocytochemistry/Immunofluorescence: AICDA Antibody [NBP1-30955] - Analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: AICDA Antibody [NBP1-30955] - Paraffin-embedded mouse lymph node. AICDA antibody [N1N2], N-term dilution: 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
FIG4 Antibody
26160002
Immunohistochemistry: FIG4 Antibody [26160002] - Most of the normal tissues displayed moderate to strong cytoplasmic positivity which was occasionally accompanied with nuclear staining. Malignant tissues exhibited in most cases moderate cytoplasmic immunoreactivity. Strong staining was observed in several tumors but was most prominent in colo-rectal and stomach cancers. Image and statement courtesy of the Human Protein Atlas (HPA).
ELISA: FIG4 Antibody [26160002]
(3 Publications)
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
PIKFyve/PIP5K3
Antibody (6C7)
H00200576-M01
Western Blot: PIKFyve/PIP5K3 Antibody (6C7) [H00200576-M01] - Analysis of PIP5K3 expression in transfected 293T cell line by PIP5K3 monoclonal antibody (M01), clone 6C7.Lane 1: PIP5K3 transfected lysate(50.2 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: PIKFyve/PIP5K3 Antibody (6C7) [H00200576-M01] - Analysis of monoclonal antibody to PIP5K3 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: PIKFyve/PIP5K3 Antibody (6C7) [H00200576-M01] - Analysis of monoclonal antibody to PIP5K3 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
(3 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
VAC14 Knockout
HeLa Cell Lysate
NBP2-65123
VAC14 Knockout HeLa Cell Lysate
Species: Hu
Niemann-Pick C1
Antibody
NB400-148
Western Blot: Niemann-Pick C1 Antibody [NB400-148] - Hela lysate, BHK lysate, A431 lysate tested at 1:1000. Image provided by verified customer review.
Immunocytochemistry/Immunofluorescence: Niemann-Pick C1 Antibody [NB400-148] - HeLa cells were fixed and permeabilized for 10 minutes using -20C MeOH. The cells were incubated with anti-Niemann-Pick C1 at 5 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: Niemann-Pick C1 Antibody [NB400-148] - Staining of human brain, cortex, neurons and astrocytes.
(3 Reviews)
(33 Publications)
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NXF1 Antibody
NBP1-57160
Western Blot: NXF1 Antibody [NBP1-57160] - Lanes: Lane 1 : 7ug HeLa lysate +EGFP SiRNA Lane 2: 7ug HeLa lysate +NXF1 SiRNA Primary, Antibody Dilution: 1 : 300 Secondary Antibody: Anti-rabbit-HRP Secondary, Antibody Dilution: 1 : 500 Gene name: NXF1.
Immunohistochemistry-Paraffin: NXF1 Antibody [NBP1-57160] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: NXF1 Antibody [NBP1-57160] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml
Species: Hu
Applications: WB, IHC, IHC-P, KD
APOBEC3B Knockout
HeLa Cell Lysate
NBP2-64893
APOBEC3B Knockout HeLa Cell Lysate
Species: Hu
Citidine Deaminase
Antibody
NBP2-39019
Western Blot: Citidine Deaminase Antibody [NBP2-39019] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue
Immunocytochemistry/Immunofluorescence: Citidine Deaminase Antibody [NBP2-39019] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Citidine Deaminase Antibody [NBP2-39019] - Staining of human cerebral cortex shows low expression as expected.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(19 Reviews)
(507 Publications)
Species: Hu
RAE1 Antibody
NB100-1894
Western Blot: RAE1 Antibody [NB100-1894] - Staining of HepG2 (A), HeLa (B), Jurkat (C) and MCF7 (D) lysates (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: RAE1 Antibody [NB100-1894] - Staining of paraffin embedded Human Heart. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: RAE1 Antibody [NB100-1894] - Staining of paraffin embedded Human Cortex. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
GLI-2 Antibody
AF3635
GLI‑2 was detected in immersion fixed frozen sections of mouse embryo (15 d.p.c.) using Goat Anti-Mouse GLI‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3635) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling when primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. Specific staining was localized to developing muscle. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(2 Reviews)
(10 Publications)
Species: Mu
Applications: WB, IHC
Galanin Antibody
NBP2-33582
Immunocytochemistry/Immunofluorescence: Galanin Antibody [NBP2-33582] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582] - Staining in human appendix and cerebral cortex tissues using anti-GAL antibody. Corresponding GAL RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582] - Rhesus monkey (Macaca mulatta) gingival sections stained with anti-galanin antibody. Antibody diluted 1:1000. This image was submitted via customer Review.
(1 Review)
(1 Publication)
Species: Hu, Mk
Applications: ICC/IF, IHC, IHC-P
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - WB analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(2 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
CD45 Antibody
(30-F11)
NB100-77417
Immunohistochemistry-Paraffin: CD45 Antibody (30-F11) [NB100-77417] - IHC analysis of formalin fixed and paraffin embedded section of mouse spleen using rat monoclonal CD45 antibody (clone 30-F11) at 1:50 dilution. The antibody generated an expected membrane staining in the red and white pulp spleenocytes of the tested spleen section.
Immunohistochemistry-Frozen: CD45 Antibody (30-F11) [NB100-77417] - IHC analysis of a mouse spleen cryosection using CD45 antibody clone 30-F11 at 1:50 dilution. The signal was detected using goat anti-rat Alexa fluor 488 secondary with DAPI counterstaining. Image submitted via a verified customer review.
Flow Cytometry: CD45 Antibody (30-F11) [NB100-77417] - Analysis of CD45 (30F11) in freshly isolated mouse (Balb C) splenocytes (1x10^6) were stained with CD45 antibody (NB100-77417) at 1:1000 dilution and detected with FITC conjugated donkey anti-rat IgG secondary (orange). Shown with rat IgG isotype control (blue).
(4 Reviews)
(18 Publications)
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
SACM1L Antibody
H00022908-D01P
Western Blot: SACM1L Antibody [H00022908-D01P] - Analysis of SACM1L expression in transfected 293T cell line by SACM1L polyclonal antibody.Lane 1: SACM1L transfected lysate(67.00 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: SACM1L Antibody [H00022908-D01P] - Analysis of antibody to SACM1L on HeLa cell. Antibody concentration 30 ug/ml.
Species: Hu
Applications: WB, ELISA, ICC/IF
TREX2 Antibody
NBP1-76978
Western Blot: TREX2 Antibody [NBP1-76978] - Rat liver tissue lysate with TREX2 antibody at 2.5 ug/ml.
Immunocytochemistry/Immunofluorescence: TREX2 Antibody [NBP1-76978] - Immunofluorescence of TREX2 in Human Liver cells with TREX2 antibody at 20 ug/mL.
Immunohistochemistry-Paraffin: TREX2 Antibody [NBP1-76978] - Human liver tissue with TREX2 antibody at 2.5 ug/ml.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
PU.1/Spi-1 Antibody
NBP2-27163
Western Blot: PU.1/Spi-1 Antibody [NBP2-27163] - PU.1/Spi1 Antibody [NBP2-27163] - Analysis of PU.1/Spi1 in U937 cell lysate in the 1) absence and 2) presence of immunizing peptide using NBP2-27163.
Flow Cytometry: PU.1/Spi-1 Antibody [NBP2-27163] - PU.1/Spi1 Antibody [NBP2-27163] - Intracellular analysis of PU.1 in mouse RAW cells (top) and PMA treated (20 ng/ml, overnight) human ThP1 cells (bottom) using 1.25 ug/10^6 cells. Green peak represents isotype control this antibody ; red represents anti-PU.1 antibody.
Western Blot: PU.1/Spi1 Antibody [NBP2-27163] - analysis of 293T cell lysate (30ug) using anti-PU.1/Spi1 antibody. Image from verified customer review.
(1 Review)
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
Shugoshin Antibody
(3C11)
H00151648-M01
Western Blot: Shugoshin Antibody (3C11) [H00151648-M01] - Analysis of SGOL1 expression in transfected 293T cell line by SGOL1 monoclonal antibody (M01), clone 3C11.Lane 1: SGOL1 transfected lysate(33.5 KDa).Lane 2: Non-transfected lysate.
Immunoprecipitation: Shugoshin Antibody (3C11) [H00151648-M01] - Analysis of SGOL1 transfected lysate using anti-SGOL1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SGOL1 MaxPab rabbit polyclonal antibody.
(14 Publications)
Species: Hu
Applications: WB, ELISA, IP
ADCY10 Antibody
NBP1-59040
Western Blot: ADCY10 Antibody [NBP1-59040] - Human Brain lysate, concentration 0.2-1 ug/ml.
Species: Hu
Applications: WB

Publications for MCM3AP Antibody (NBP1-83393)(1)


Reviews for MCM3AP Antibody (NBP1-83393) (0)

There are no reviews for MCM3AP Antibody (NBP1-83393). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MCM3AP Antibody (NBP1-83393) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for MCM3AP Antibody (NBP1-83393)

Discover related pathways, diseases and genes to MCM3AP Antibody (NBP1-83393). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCM3AP Antibody (NBP1-83393)

Discover more about diseases related to MCM3AP Antibody (NBP1-83393).
 

Pathways for MCM3AP Antibody (NBP1-83393)

View related products by pathway.

PTMs for MCM3AP Antibody (NBP1-83393)

Learn more about PTMs related to MCM3AP Antibody (NBP1-83393).

Blogs on MCM3AP

There are no specific blogs for MCM3AP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MCM3AP Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol MCM3AP