MCM3AP Antibody

Immunocytochemistry/Immunofluorescence: MCM3AP Antibody [NBP1-83393] - Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear membrane & cytosol.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

MCM3AP Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HEPAEDSDPLSRGDHPPDKRPVRLNRPRGGTLFGRTIQDVFKSNKEVGRLGNKEAKKETGFVESAESDHMAIPGGNQSVLAPSRIPGVNKEEETESREKKEDSLRGTPARQSNRSESTDSLGGLSPSEVTAIQCKNIPDYL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MCM3AP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MCM3AP Protein (NBP1-83393PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%). Reactivity reported in scientific literature (PMID: 23652018)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MCM3AP Antibody

• 80 kDa MCM3-associated protein
• FLJ44336
• GANPFLJ45306
• human mRNA for MCM3 import factor10Protein GANP
• KIAA0572MAP80germinal center-associated nuclear protein
• Map80
• MCM3 import protein
• MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) associated protein
• MCM3 minichromosome maintenance deficient 3 associated protein
• minichromosome maintenance complex component 3 associated protein
• minichromosome maintenance deficient (S. cerevisiae) 3-associated protein
• minichromosome maintenance deficient 3-associated protein

Background

The mini-chromosome maintenance (MCM) family of proteins, including MCM2, MCM3, MCM4 (Cdc21), MCM5 (Cdc46), MCM6 (Mis5) and MCM7 (Cdc47), are regulators of DNA replication that act to ensure replication occurs only once in the cell cycle. Expression of MCM proteins increases during cell growth, peaking at G1 to S phase. The MCM proteins each contain an ATP-binding motif, which is predicted to mediate ATP-dependent opening of double-stranded DNA. MCM proteins are regulated by E2F transcription factors, which induce MCM expression, and by protein kinases, which interact with MCM proteins to maintain the postreplicative state of the cell. MCM2/MCM4 complexes function as substrates for Cdc2/cyclin B in vitro. Cleavage of MCM3, which can be prevented by caspase inhibitors, results in the inactivation of the MCM complex (composed of at least MCM proteins 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MCM3AP Antibody (NBP1-83393)(1)

Publication using NBP1-83393

• Singh SK, Maeda K, Eid MM et al. GANP regulates recruitment of AID to immunoglobulin variable regions by modulating transcription and nucleosome occupancy. Nat Commun 2013-01-01 [PMID: 23652018]

Bioinformatics

• Gene Symbol: MCM3AP