MCM3AP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MCM3AP Antibody [NBP1-83393] - Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear membrane & cytosol.
Immunohistochemistry-Paraffin: MCM3AP Antibody [NBP1-83393] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MCM3AP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HEPAEDSDPLSRGDHPPDKRPVRLNRPRGGTLFGRTIQDVFKSNKEVGRLGNKEAKKETGFVESAESDHMAIPGGNQSVLAPSRIPGVNKEEETESREKKEDSLRGTPARQSNRSESTDSLGGLSPSEVTAIQCKNIPDYL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MCM3AP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MCM3AP Protein (NBP1-83393PEP)
Publications
Read Publication using NBP1-83393.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (82%). Reactivity reported in scientific literature (PMID: 23652018)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MCM3AP Antibody

  • 80 kDa MCM3-associated protein
  • FLJ44336
  • GANPFLJ45306
  • human mRNA for MCM3 import factor10Protein GANP
  • KIAA0572MAP80germinal center-associated nuclear protein
  • Map80
  • MCM3 import protein
  • MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) associated protein
  • MCM3 minichromosome maintenance deficient 3 associated protein
  • minichromosome maintenance complex component 3 associated protein
  • minichromosome maintenance deficient (S. cerevisiae) 3-associated protein
  • minichromosome maintenance deficient 3-associated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-249
Species: Hu
Applications: WB, IHC, PLA, ICC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
26160002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00200576-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00055697-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57516
Species: Hu
Applications: WB
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1894
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-33582
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
H00022908-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-76978
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
H00151648-M01
Species: Hu
Applications: WB, ELISA, IP
NBP1-81765
Species: Hu
Applications: IHC, IHC-P

Publications for MCM3AP Antibody (NBP1-83393)(1)

Reviews for MCM3AP Antibody (NBP1-83393) (0)

There are no reviews for MCM3AP Antibody (NBP1-83393). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MCM3AP Antibody (NBP1-83393) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MCM3AP Products

Bioinformatics Tool for MCM3AP Antibody (NBP1-83393)

Discover related pathways, diseases and genes to MCM3AP Antibody (NBP1-83393). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCM3AP Antibody (NBP1-83393)

Discover more about diseases related to MCM3AP Antibody (NBP1-83393).
 

Pathways for MCM3AP Antibody (NBP1-83393)

View related products by pathway.

PTMs for MCM3AP Antibody (NBP1-83393)

Learn more about PTMs related to MCM3AP Antibody (NBP1-83393).

Blogs on MCM3AP

There are no specific blogs for MCM3AP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MCM3AP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MCM3AP